Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE8RAKZ)

• DOT Name: Cytosolic Fe-S cluster assembly factor NUBP1 (NUBP1)
• Synonyms: Nucleotide-binding protein 1; NBP 1
• Gene Name: NUBP1
• Related Disease:
  Type-1/2 diabetes
  Advanced cancer
  Alzheimer disease
  Brain disease
  Cerebral infarction
  Colorectal carcinoma
  Neoplasm
  Parkinson disease
  Vascular dementia
  Cognitive impairment
  Neuroblastoma
  Stroke
• UniProt ID: NUBP1_HUMAN
• Pfam ID: PF10609
• Sequence:
  MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVL
  SGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPV
  YVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEH
  LSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKK
  ESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSII
  QRIQEFCNLHQSKEENLISS
• Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Implicated in the regulation of centrosome duplication. Negatively regulates cilium formation and structure.
• Reactome Pathway: Cytosolic iron-sulfur cluster assembly (R-HSA-2564830)

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Brain disease	DIS6ZC3X	Strong	Biomarker	[3]
Cerebral infarction	DISR1WNP	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
Neoplasm	DISZKGEW	Strong	Altered Expression	[5]
Parkinson disease	DISQVHKL	Strong	Biomarker	[6]
Vascular dementia	DISVO82H	Strong	Biomarker	[7]
Cognitive impairment	DISH2ERD	Limited	Biomarker	[8]
Neuroblastoma	DISVZBI4	Limited	Posttranslational Modification	[9]
Stroke	DISX6UHX	Limited	Biomarker	[10]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cytosolic Fe-S cluster assembly factor NUBP1 (NUBP1).	[11]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Cytosolic Fe-S cluster assembly factor NUBP1 (NUBP1).	[12]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Cytosolic Fe-S cluster assembly factor NUBP1 (NUBP1).	[14]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Cytosolic Fe-S cluster assembly factor NUBP1 (NUBP1).	[13]

References

• [1] L-3-n-butylphthalide attenuates cognitive deficits in db/db diabetic mice.Metab Brain Dis. 2019 Feb;34(1):309-318. doi: 10.1007/s11011-018-0356-6. Epub 2018 Dec 1.
• [2] Conservative Surgical Treatment of Bisphosphonate-Related Osteonecrosis of the Jaw with Er,Cr:YSGG Laser and Platelet-Rich Plasma: A Longitudinal Study.Biomed Res Int. 2018 Aug 19;2018:3982540. doi: 10.1155/2018/3982540. eCollection 2018.
• [3] Protective Effects of L-3-n-Butylphthalide Against H(2)O(2)-Induced Injury in Neural Stem Cells by Activation of PI3K/Akt and Mash1 Pathway.Neuroscience. 2018 Nov 21;393:164-174. doi: 10.1016/j.neuroscience.2018.10.003. Epub 2018 Oct 12.
• [4] dl-3-n-butylphthalide promotes neuroplasticity and motor recovery in stroke rats.Behav Brain Res. 2017 Jun 30;329:67-74. doi: 10.1016/j.bbr.2017.04.039. Epub 2017 Apr 22.
• [5] Expression of family with sequence similarity 172 member A and nucleotide-binding protein 1 is associated with the poor prognosis of colorectal carcinoma.Oncol Lett. 2017 Sep;14(3):3587-3593. doi: 10.3892/ol.2017.6585. Epub 2017 Jul 15.
• [6] L-3-n-butylphthalide soft capsules in the treatment of Parkinson disease dementia: A systematic review and meta-analysis of randomized controlled trials.Medicine (Baltimore). 2019 Jun;98(24):e16082. doi: 10.1097/MD.0000000000016082.
• [7] L-butyl phthalein improves neural function of vascular dementia mice by regulating the PI3K/AKT signaling pathway.Eur Rev Med Pharmacol Sci. 2018 Aug;22(16):5377-5384. doi: 10.26355/eurrev_201808_15740.
• [8] L-3-n-Butylphthalide Regulates Proliferation, Migration, and Differentiation of Neural Stem Cell In Vitro and Promotes Neurogenesis in APP/PS1 Mouse Model by Regulating BDNF/TrkB/CREB/Akt Pathway.Neurotox Res. 2018 Oct;34(3):477-488. doi: 10.1007/s12640-018-9905-3. Epub 2018 May 4.
• [9] L-3-n-butylphthalide reduces tau phosphorylation and improves cognitive deficits in APP/PS1-Alzheimer's transgenic mice.J Alzheimers Dis. 2012;29(2):379-91. doi: 10.3233/JAD-2011-111577.
• [10] L-NBP, a multiple growth factor activator, attenuates ischemic neuronal impairments possibly through promoting neuritogenesis.Neurochem Int. 2019 Mar;124:94-105. doi: 10.1016/j.neuint.2019.01.002. Epub 2019 Jan 7.
• [11] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [14] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.