General Information of Drug Off-Target (DOT) (ID: OTFS4IKJ)

DOT Name Secretory carrier-associated membrane protein 1 (SCAMP1)
Synonyms Secretory carrier membrane protein 1
Gene Name SCAMP1
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Her2-receptor negative breast cancer ( )
HER2/NEU overexpressing breast cancer ( )
Idiopathic thrombocytopenic purpura ( )
Neoplasm ( )
Clear cell renal carcinoma ( )
Gallbladder cancer ( )
Gallbladder carcinoma ( )
Pancreatic cancer ( )
Renal cell carcinoma ( )
UniProt ID
SCAM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04144
Sequence
MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQ
PAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNW
PPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSAR
AVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFH
NWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQ
QEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI
Function Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Tissue Specificity Widely expressed, with highest expression in brain.
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Biomarker [1]
Breast carcinoma DIS2UE88 Strong Biomarker [1]
Her2-receptor negative breast cancer DISS605N Strong Biomarker [1]
HER2/NEU overexpressing breast cancer DISYKID5 Strong Biomarker [1]
Idiopathic thrombocytopenic purpura DISFKGJU Strong Biomarker [2]
Neoplasm DISZKGEW Disputed Altered Expression [3]
Clear cell renal carcinoma DISBXRFJ Limited Biomarker [4]
Gallbladder cancer DISXJUAF Limited Biomarker [5]
Gallbladder carcinoma DISD6ACL Limited Biomarker [5]
Pancreatic cancer DISJC981 Limited Altered Expression [5]
Renal cell carcinoma DISQZ2X8 Limited Biomarker [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
18 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [6]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [7]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [8]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [9]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [10]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [12]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [13]
Selenium DM25CGV Approved Selenium decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [14]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [15]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [16]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [7]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [17]
Clodronate DM9Y6X7 Approved Clodronate increases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [7]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [18]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [19]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Secretory carrier-associated membrane protein 1 (SCAMP1). [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 18 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Secretory carrier-associated membrane protein 1 (SCAMP1). [20]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Secretory carrier-associated membrane protein 1 (SCAMP1). [20]
------------------------------------------------------------------------------------

References

1 MTSS1 and SCAMP1 cooperate to prevent invasion in breast cancer.Cell Death Dis. 2018 Mar 1;9(3):344. doi: 10.1038/s41419-018-0364-9.
2 Increasing observation rates in low-risk pediatric immune thrombocytopenia using a standardized clinical assessment and management plan (SCAMP() ).Pediatr Blood Cancer. 2017 May;64(5):10.1002/pbc.26303. doi: 10.1002/pbc.26303. Epub 2016 Oct 26.
3 Gene expression in early stage cervical cancer.Gynecol Oncol. 2008 Mar;108(3):520-6. doi: 10.1016/j.ygyno.2007.11.024. Epub 2008 Jan 11.
4 LncRNA SCAMP1 regulates ZEB1/JUN and autophagy to promote pediatric renal cell carcinoma under oxidative stress via miR-429.Biomed Pharmacother. 2019 Dec;120:109460. doi: 10.1016/j.biopha.2019.109460. Epub 2019 Sep 21.
5 Inhibition of SCAMP1 suppresses cell migration and invasion in human pancreatic and gallbladder cancer cells.Tumour Biol. 2013 Oct;34(5):2731-9. doi: 10.1007/s13277-013-0825-9. Epub 2013 May 8.
6 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
7 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
8 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
11 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
12 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
13 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
14 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
15 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
16 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
17 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
18 Gene expression profiling in Caco-2 human colon cells exposed to TCDD, benzo[a]pyrene, and natural Ah receptor agonists from cruciferous vegetables and citrus fruits. Toxicol In Vitro. 2008 Mar;22(2):396-410.
19 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
20 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
21 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.