Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIAADPA)

DOT Name	Transcription factor ETV7 (ETV7)
Synonyms	ETS translocation variant 7; ETS-related protein Tel2; Tel-related Ets factor; Transcription factor Tel-2
Gene Name	ETV7
Related Disease	Advanced cancer ( ) Breast cancer ( ) Breast carcinoma ( ) Haematological malignancy ( ) leukaemia ( ) Leukemia ( ) Nasopharyngeal carcinoma ( ) Neoplasm ( ) Plasma cell myeloma ( ) Rhabdomyosarcoma ( ) Myocardial ischemia ( ) Adult lymphoma ( ) Lymphoma ( ) Pediatric lymphoma ( )
UniProt ID	ETV7_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00178 ; PF02198
Sequence	MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVL HWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL VCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLA RWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYE PYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKL LFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
Function	Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.
Tissue Specificity	Expressed in hematopoietic tissues.
KEGG Pathway	Transcriptio.l misregulation in cancer (hsa05202 )

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Haematological malignancy	DISCDP7W	Strong	Altered Expression	[3]
leukaemia	DISS7D1V	Strong	Altered Expression	[4]
Leukemia	DISNAKFL	Strong	Altered Expression	[4]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Altered Expression	[5]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[6]
Rhabdomyosarcoma	DISNR7MS	Strong	Altered Expression	[1]
Myocardial ischemia	DISFTVXF	moderate	Biomarker	[7]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[8]
Lymphoma	DISN6V4S	Limited	Biomarker	[8]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 14 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription factor ETV7 (ETV7).	[9]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Transcription factor ETV7 (ETV7).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transcription factor ETV7 (ETV7).	[11]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Transcription factor ETV7 (ETV7).	[12]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transcription factor ETV7 (ETV7).	[13]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Transcription factor ETV7 (ETV7).	[14]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	ETV7 is an essential component of a rapamycin-insensitive mTOR complex in cancer. Sci Adv. 2018 Sep 12;4(9):eaar3938.
2	ETV7-Mediated DNAJC15 Repression Leads to Doxorubicin Resistance in Breast Cancer Cells.Neoplasia. 2018 Aug;20(8):857-870. doi: 10.1016/j.neo.2018.06.008. Epub 2018 Jul 17.
3	Establishment of a transgenic mouse to model ETV7 expressing human tumors.Transgenic Res. 2019 Feb;28(1):115-128. doi: 10.1007/s11248-018-0104-z. Epub 2018 Nov 27.
4	The ETS factor TEL2 is a hematopoietic oncoprotein.Blood. 2006 Feb 1;107(3):1124-32. doi: 10.1182/blood-2005-03-1196. Epub 2005 Oct 18.
5	Snail promotes metastasis of nasopharyngeal carcinoma partly by down-regulating TEL2.Cancer Commun (Lond). 2018 Sep 25;38(1):58. doi: 10.1186/s40880-018-0328-6.
6	SCFFbxo9 and CK2 direct the cellular response to growth factor withdrawal via Tel2/Tti1 degradation and promote survival in multiple myeloma.Nat Cell Biol. 2013 Jan;15(1):72-81. doi: 10.1038/ncb2651.
7	The effects of Tel2 on cardiomyocyte survival.Life Sci. 2019 Sep 1;232:116665. doi: 10.1016/j.lfs.2019.116665. Epub 2019 Jul 16.
8	The novel ETS factor TEL2 cooperates with Myc in B lymphomagenesis.Mol Cell Biol. 2005 Mar;25(6):2395-405. doi: 10.1128/MCB.25.6.2395-2405.2005.
9	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
10	Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
11	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
12	Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
13	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
14	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.