Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIEYVBW)

DOT Name Reactive oxygen species modulator 1 (ROMO1)
Synonyms ROS modulator 1; Epididymis tissue protein Li 175; Glyrichin; Mitochondrial targeting GxxxG motif protein; MTGM; Protein MGR2 homolog
Gene Name ROMO1
Related Disease
B-cell neoplasm ( )
Diabetic retinopathy ( )
Non-insulin dependent diabetes ( )
Subarachnoid hemorrhage ( )
Adenocarcinoma ( )
Advanced cancer ( )
Colorectal carcinoma ( )
Fanconi anemia complementation group A ( )
Fanconi's anemia ( )
Gastric cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Pleural tuberculosis ( )
Pulmonary fibrosis ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Glioblastoma multiforme ( )
Bladder cancer ( )
Chronic obstructive pulmonary disease ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
UniProt ID
ROMO1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF10247
Sequence
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
Function
Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.; Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage.
Tissue Specificity Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line. Highly expressed in brain tumors.

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
B-cell neoplasm DISVY326 Definitive Biomarker [1]
Diabetic retinopathy DISHGUJM Definitive Genetic Variation [2]
Non-insulin dependent diabetes DISK1O5Z Definitive Genetic Variation [2]
Subarachnoid hemorrhage DISI7I8Y Definitive Biomarker [1]
Adenocarcinoma DIS3IHTY Strong Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [5]
Fanconi anemia complementation group A DIS8PZLI Strong Altered Expression [6]
Fanconi's anemia DISGW6Q8 Strong Altered Expression [6]
Gastric cancer DISXGOUK Strong Genetic Variation [7]
Lung cancer DISCM4YA Strong Altered Expression [4]
Lung carcinoma DISTR26C Strong Altered Expression [4]
Neoplasm DISZKGEW Strong Altered Expression [8]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [9]
Pleural tuberculosis DISD09EG Strong Altered Expression [3]
Pulmonary fibrosis DISQKVLA Strong Biomarker [10]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [3]
Stomach cancer DISKIJSX Strong Genetic Variation [7]
Glioblastoma multiforme DISK8246 moderate Biomarker [11]
Bladder cancer DISUHNM0 Limited Altered Expression [12]
Chronic obstructive pulmonary disease DISQCIRF Limited Altered Expression [13]
Urinary bladder cancer DISDV4T7 Limited Altered Expression [12]
Urinary bladder neoplasm DIS7HACE Limited Altered Expression [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 23 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Reactive oxygen species modulator 1 (ROMO1). [14]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Reactive oxygen species modulator 1 (ROMO1). [15]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Reactive oxygen species modulator 1 (ROMO1). [16]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Reactive oxygen species modulator 1 (ROMO1). [17]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Reactive oxygen species modulator 1 (ROMO1). [18]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Reactive oxygen species modulator 1 (ROMO1). [19]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Reactive oxygen species modulator 1 (ROMO1). [20]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Reactive oxygen species modulator 1 (ROMO1). [21]
chloropicrin DMSGBQA Investigative chloropicrin affects the expression of Reactive oxygen species modulator 1 (ROMO1). [22]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos increases the expression of Reactive oxygen species modulator 1 (ROMO1). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Mitophagy Reduces Oxidative Stress Via Keap1 (Kelch-Like Epichlorohydrin-Associated Protein 1)/Nrf2 (Nuclear Factor-E2-Related Factor 2)/PHB2 (Prohibitin 2) Pathway After Subarachnoid Hemorrhage in Rats.Stroke. 2019 Apr;50(4):978-988. doi: 10.1161/STROKEAHA.118.021590.
2 The rs6060566 of the reactive oxygen species modulator 1 (Romo-1) gene affects Romo-1 expression and the development of diabetic retinopathy in Caucasians with type 2 diabetes.Acta Ophthalmol. 2015 Dec;93(8):e654-7. doi: 10.1111/aos.12723. Epub 2015 Mar 30.
3 Reactive oxygen species modulator 1 (Romo1) as a novel diagnostic marker for lung cancer-related malignant effusion.Medicine (Baltimore). 2017 Jan;96(4):e5975. doi: 10.1097/MD.0000000000005975.
4 Reactive Oxygen Species Modulator 1 As An Adverse Prognostic Marker In Stage III Non-Small Cell Lung Cancer Treated With Radiotherapy: A Retrospective Pilot Study.Onco Targets Ther. 2019 Oct 9;12:8263-8273. doi: 10.2147/OTT.S217514. eCollection 2019.
5 Reactive oxygen species modulator-1 (Romo1) predicts unfavorable prognosis in colorectal cancer patients.PLoS One. 2017 May 4;12(5):e0176834. doi: 10.1371/journal.pone.0176834. eCollection 2017.
6 ROMO1 regulates RedOx states and serves as an inducer of NF-B-driven EMT factors in Fanconi anemia.Cancer Lett. 2015 May 28;361(1):33-8. doi: 10.1016/j.canlet.2015.02.020. Epub 2015 Feb 14.
7 Association of Romo1 gene genetic polymorphisms with risk of gastric cancer in northwestern Chinese population.Pathol Oncol Res. 2015 Jul;21(3):581-7. doi: 10.1007/s12253-014-9858-7. Epub 2014 Nov 6.
8 Reactive Oxygen Species Modulator 1 (Romo1) Predicts Poor Outcomes in Advanced Non-small Cell Lung Cancer Patients Treated with Platinum-Based Chemotherapy.Cancer Res Treat. 2017 Jan;49(1):141-149. doi: 10.4143/crt.2016.133. Epub 2016 May 18.
9 Clinical value of combined detection of reactive oxygen species modulator 1 and adenosine deaminase in pleural effusion in the identification of NSCLC associated malignant pleural effusion.J Clin Lab Anal. 2020 Mar;34(3):e23091. doi: 10.1002/jcla.23091. Epub 2019 Nov 10.
10 Reactive oxygen species modulator 1 regulates oxidative stress and induces renal and pulmonary fibrosis in a unilateral ureteral obstruction rat model and in HK? cells.Mol Med Rep. 2017 Oct;16(4):4855-4862. doi: 10.3892/mmr.2017.7161. Epub 2017 Aug 3.
11 Romo1 is associated with ROS production and cellular growth in human gliomas.J Neurooncol. 2015 Jan;121(1):73-81. doi: 10.1007/s11060-014-1608-x. Epub 2014 Sep 6.
12 Long noncoding RNA LINC00319 regulates ROMO1 expression and promotes bladder cancer progression via miR-4492/ROMO1 axis.J Cell Physiol. 2020 Apr;235(4):3768-3775. doi: 10.1002/jcp.29271. Epub 2019 Oct 14.
13 Increased Serum Romo1 Was Correlated with Lung Function, Inflammation, and Oxidative Stress in Chronic Obstructive Pulmonary Disease.Inflammation. 2019 Oct;42(5):1555-1560. doi: 10.1007/s10753-019-01017-x.
14 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
15 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
16 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
17 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
18 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
19 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
20 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
21 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
22 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
23 Chlorpyrifos induces NLRP3 inflammasome and pyroptosis/apoptosis via mitochondrial oxidative stress in human keratinocyte HaCaT cells. Toxicology. 2015 Dec 2;338:37-46. doi: 10.1016/j.tox.2015.09.006. Epub 2015 Oct 3.