Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJBLUQE)

• DOT Name: T-lymphocyte activation antigen CD80 (CD80)
• Synonyms: Activation B7-1 antigen; BB1; CTLA-4 counter-receptor B7.1; B7; CD antigen CD80
• Gene Name: CD80
• UniProt ID: CD80_HUMAN
• PDB ID: 1DR9; 1I8L; 7TPS; 8HXA
• Pfam ID: PF08205 ; PF07686
• Sequence:
  MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
  QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
  YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
  ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
  DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV
• Function: Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation; (Microbial infection) Acts as a receptor for adenovirus subgroup B.
• Tissue Specificity: Expressed on activated B-cells, macrophages and dendritic cells.
• KEGG Pathway:
  Virion - Adenovirus (hsa03267)
  Cell adhesion molecules (hsa04514)
  Toll-like receptor sig.ling pathway (hsa04620)
  Intesti.l immune network for IgA production (hsa04672)
  Type I diabetes mellitus (hsa04940)
  Autoimmune thyroid disease (hsa05320)
  Systemic lupus erythematosus (hsa05322)
  Rheumatoid arthritis (hsa05323)
  Allograft rejection (hsa05330)
  Graft-versus-host disease (hsa05332)
  Viral myocarditis (hsa05416)
• Reactome Pathway:
  Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)
  CD28 co-stimulation (R-HSA-389356)
  CD28 dependent PI3K/Akt signaling (R-HSA-389357)
  CD28 dependent Vav1 pathway (R-HSA-389359)
  CTLA4 inhibitory signaling (R-HSA-389513)
  Interleukin-10 signaling (R-HSA-6783783)
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558)
  PIP3 activates AKT signaling (R-HSA-1257604)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Melphalan	DMOLNHF	Approved	T-lymphocyte activation antigen CD80 (CD80) increases the Injury ADR of Melphalan.	[21]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of T-lymphocyte activation antigen CD80 (CD80).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[4]
Marinol	DM70IK5	Approved	Marinol decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[6]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[7]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[8]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[9]
DTI-015	DMXZRW0	Approved	DTI-015 increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[10]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[8]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[11]
Tacrolimus	DMZ7XNQ	Approved	Tacrolimus decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[11]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[12]
MK-2206	DMT1OZ6	Phase 2	MK-2206 decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[13]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[16]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[7]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[17]
Benzoquinone	DMNBA0G	Investigative	Benzoquinone increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[18]
muramyl dipeptide	DM4FR71	Investigative	muramyl dipeptide increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[19]
hydroxycitronellal	DMFHCV9	Investigative	hydroxycitronellal increases the expression of T-lymphocyte activation antigen CD80 (CD80).	[20]
2-chloro-5-nitro-N-phenylbenzamide	DMUGQIV	Investigative	2-chloro-5-nitro-N-phenylbenzamide decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[8]
24(S), 25-epoxycholesterol	DMW2KI5	Investigative	24(S), 25-epoxycholesterol decreases the expression of T-lymphocyte activation antigen CD80 (CD80).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of T-lymphocyte activation antigen CD80 (CD80).	[14]

References

• [1] Differential expression of dendritic cell markers by all-trans retinoic acid on human acute promyelocytic leukemic cell line. Int Immunopharmacol. 2004 Dec 15;4(13):1587-601. doi: 10.1016/j.intimp.2004.07.010.
• [2] Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
• [3] 1 Alpha,25-dihydroxyvitamin D3 inhibits differentiation, maturation, activation, and survival of dendritic cells leading to impaired alloreactive T cell activation. J Immunol. 2000 Mar 1;164(5):2405-11. doi: 10.4049/jimmunol.164.5.2405.
• [4] Treatment of chronic lymphocytic leukemia with a hypomethylating agent induces expression of NXF2, an immunogenic cancer testis antigen. Clin Cancer Res. 2009 May 15;15(10):3406-15. doi: 10.1158/1078-0432.CCR-08-2099. Epub 2009 Apr 28.
• [5] Suppression by (9)-tetrahydrocannabinol of the primary immunoglobulin M response by human peripheral blood B cells is associated with impaired STAT3 activation. Toxicology. 2013 Aug 9;310:84-91. doi: 10.1016/j.tox.2013.05.009. Epub 2013 May 29.
• [6] Defective gammadelta T-cell function and granzyme B gene polymorphism in a cohort of newly diagnosed breast cancer patients. Exp Hematol. 2009 Jul;37(7):838-48. doi: 10.1016/j.exphem.2009.04.003. Epub 2009 May 14.
• [7] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [8] 9-cis-Retinoic acid (9cRA), a retinoid X receptor (RXR) ligand, exerts immunosuppressive effects on dendritic cells by RXR-dependent activation: inhibition of peroxisome proliferator-activated receptor gamma blocks some of the 9cRA activities, and precludes them to mature phenotype development. J Immunol. 2007 May 15;178(10):6130-9. doi: 10.4049/jimmunol.178.10.6130.
• [9] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [10] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [11] Tacrolimus ointment causes inflammatory dendritic epidermal cell depletion but no Langerhans cell apoptosis in patients with atopic dermatitis. J Allergy Clin Immunol. 2004 Jul;114(1):137-43. doi: 10.1016/j.jaci.2004.03.021.
• [12] Di-n-butyl phthalate modifies PMA-induced macrophage differentiation of THP-1 monocytes via PPAR. Toxicol In Vitro. 2019 Feb;54:168-177. doi: 10.1016/j.tiv.2018.09.004. Epub 2018 Sep 12.
• [13] Chemerin promotes the pathogenesis of preeclampsia by activating CMKLR1/p-Akt/CEBP axis and inducing M1 macrophage polarization. Cell Biol Toxicol. 2022 Aug;38(4):611-628. doi: 10.1007/s10565-021-09636-7. Epub 2021 Aug 16.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [15] Inhibition of Super-Enhancer Activity in Autoinflammatory Site-Derived T Cells Reduces Disease-Associated Gene Expression. Cell Rep. 2015 Sep 29;12(12):1986-96. doi: 10.1016/j.celrep.2015.08.046. Epub 2015 Sep 17.
• [16] Repercussions of Bisphenol A on the Physiology of Human Osteoblasts. Int J Mol Sci. 2022 May 11;23(10):5349. doi: 10.3390/ijms23105349.
• [17] Innate stimulatory capacity of high molecular weight transition metals Au (gold) and Hg (mercury). Toxicol In Vitro. 2015 Mar;29(2):363-9. doi: 10.1016/j.tiv.2014.10.010. Epub 2014 Oct 30.
• [18] Mechanistic understanding of dendritic cell activation in skin sensitization: additional evidences to support potency classification. Toxicol Lett. 2020 Apr 1;322:50-57. doi: 10.1016/j.toxlet.2020.01.014. Epub 2020 Jan 17.
• [19] Synergistic effect of Nod1 and Nod2 agonists with toll-like receptor agonists on human dendritic cells to generate interleukin-12 and T helper type 1 cells. Infect Immun. 2005 Dec;73(12):7967-76. doi: 10.1128/IAI.73.12.7967-7976.2005.
• [20] Chemicals with weak skin sensitizing properties can be identified using low-density microarrays on immature dendritic cells. Toxicol Lett. 2007 Nov 1;174(1-3):98-109. doi: 10.1016/j.toxlet.2007.08.015. Epub 2007 Sep 5.
• [21] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.