Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJCSBPC)

DOT Name T-lymphocyte activation antigen CD86 (CD86)
Synonyms Activation B7-2 antigen; B70; BU63; CTLA-4 counter-receptor B7.2; FUN-1; CD antigen CD86
Gene Name CD86
UniProt ID
CD86_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1I85; 1NCN; 5YXK; 8HXB; 8HXC
Pfam ID
PF07686
Sequence
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF
Function
Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Also involved in the regulation of B cells function, plays a role in regulating the level of IgG(1) produced. Upon CD40 engagement, activates NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation; [Isoform 2]: Interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation; (Microbial infection) Acts as a receptor for adenovirus subgroup B.
Tissue Specificity Expressed by activated B-lymphocytes and monocytes.
KEGG Pathway
Virion - Adenovirus (hsa03267 )
Cell adhesion molecules (hsa04514 )
Toll-like receptor sig.ling pathway (hsa04620 )
Intesti.l immune network for IgA production (hsa04672 )
Type I diabetes mellitus (hsa04940 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Transcriptio.l misregulation in cancer (hsa05202 )
Autoimmune thyroid disease (hsa05320 )
Systemic lupus erythematosus (hsa05322 )
Rheumatoid arthritis (hsa05323 )
Allograft rejection (hsa05330 )
Graft-versus-host disease (hsa05332 )
Viral myocarditis (hsa05416 )
Reactome Pathway
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
CD28 co-stimulation (R-HSA-389356 )
CD28 dependent PI3K/Akt signaling (R-HSA-389357 )
CD28 dependent Vav1 pathway (R-HSA-389359 )
CTLA4 inhibitory signaling (R-HSA-389513 )
Interleukin-10 signaling (R-HSA-6783783 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
PIP3 activates AKT signaling (R-HSA-1257604 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
56 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of T-lymphocyte activation antigen CD86 (CD86). [1]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of T-lymphocyte activation antigen CD86 (CD86). [2]
Estradiol DMUNTE3 Approved Estradiol affects the expression of T-lymphocyte activation antigen CD86 (CD86). [3]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [4]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of T-lymphocyte activation antigen CD86 (CD86). [5]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of T-lymphocyte activation antigen CD86 (CD86). [6]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [7]
Decitabine DMQL8XJ Approved Decitabine increases the expression of T-lymphocyte activation antigen CD86 (CD86). [8]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of T-lymphocyte activation antigen CD86 (CD86). [9]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of T-lymphocyte activation antigen CD86 (CD86). [10]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of T-lymphocyte activation antigen CD86 (CD86). [12]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [13]
Alitretinoin DMME8LH Approved Alitretinoin increases the expression of T-lymphocyte activation antigen CD86 (CD86). [12]
Hydrocortisone DMGEMB7 Approved Hydrocortisone decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [14]
Nitric Oxide DM1RBYG Approved Nitric Oxide decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [15]
Testosterone Undecanoate DMZO10Y Approved Testosterone Undecanoate increases the expression of T-lymphocyte activation antigen CD86 (CD86). [16]
Tacrolimus DMZ7XNQ Approved Tacrolimus decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [14]
Betamethasone valerate DMMIAXO Approved Betamethasone valerate decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [17]
Benzyl benzoate DMDPYI5 Approved Benzyl benzoate increases the expression of T-lymphocyte activation antigen CD86 (CD86). [18]
Framycetin DMF8DNE Approved Framycetin increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
Kanamycin DM2DMPO Approved Kanamycin increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
Pyridine DMF8CJ9 Phase 4 Pyridine increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of T-lymphocyte activation antigen CD86 (CD86). [19]
Seocalcitol DMKL9QO Phase 3 Seocalcitol increases the expression of T-lymphocyte activation antigen CD86 (CD86). [20]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [13]
I3C DMIGFOR Phase 3 I3C decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [21]
Benzylpenicillin DMS9503 Phase 3 Benzylpenicillin increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
DNCB DMDTVYC Phase 2 DNCB increases the expression of T-lymphocyte activation antigen CD86 (CD86). [22]
MK-2206 DMT1OZ6 Phase 2 MK-2206 decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [23]
Eugenol DM7US1H Patented Eugenol increases the expression of T-lymphocyte activation antigen CD86 (CD86). [25]
Benzylcinnamate DMD7Z3H Patented Benzylcinnamate increases the expression of T-lymphocyte activation antigen CD86 (CD86). [18]
Tesmilifene DMPB36I Discontinued in Phase 2 Tesmilifene decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [26]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of T-lymphocyte activation antigen CD86 (CD86). [10]
Paraquat DMR8O3X Investigative Paraquat increases the expression of T-lymphocyte activation antigen CD86 (CD86). [27]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [28]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of T-lymphocyte activation antigen CD86 (CD86). [29]
geraniol DMS3CBD Investigative geraniol increases the expression of T-lymphocyte activation antigen CD86 (CD86). [30]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of T-lymphocyte activation antigen CD86 (CD86). [31]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos increases the expression of T-lymphocyte activation antigen CD86 (CD86). [32]
Linalool DMGZQ5P Investigative Linalool increases the expression of T-lymphocyte activation antigen CD86 (CD86). [33]
2-tert-butylbenzene-1,4-diol DMNXI1E Investigative 2-tert-butylbenzene-1,4-diol increases the expression of T-lymphocyte activation antigen CD86 (CD86). [34]
Benzoquinone DMNBA0G Investigative Benzoquinone increases the expression of T-lymphocyte activation antigen CD86 (CD86). [35]
NSC-1771 DMNXDGQ Investigative NSC-1771 increases the expression of T-lymphocyte activation antigen CD86 (CD86). [11]
Beta-D-Glucose DM5IHYP Investigative Beta-D-Glucose increases the expression of T-lymphocyte activation antigen CD86 (CD86). [36]
Buthionine sulfoximine DMJ46CB Investigative Buthionine sulfoximine increases the expression of T-lymphocyte activation antigen CD86 (CD86). [37]
THIOCTIC ACID DMNFCXW Investigative THIOCTIC ACID increases the expression of T-lymphocyte activation antigen CD86 (CD86). [34]
Nitrosoglutathione DMZ9WI4 Investigative Nitrosoglutathione decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [15]
CYCLOPAMINE DMEM2SW Investigative CYCLOPAMINE decreases the expression of T-lymphocyte activation antigen CD86 (CD86). [38]
muramyl dipeptide DM4FR71 Investigative muramyl dipeptide increases the expression of T-lymphocyte activation antigen CD86 (CD86). [39]
citral DM53ZGY Investigative citral increases the expression of T-lymphocyte activation antigen CD86 (CD86). [18]
hydroxycitronellal DMFHCV9 Investigative hydroxycitronellal increases the expression of T-lymphocyte activation antigen CD86 (CD86). [35]
24(S), 25-epoxycholesterol DMW2KI5 Investigative 24(S), 25-epoxycholesterol increases the expression of T-lymphocyte activation antigen CD86 (CD86). [12]
Caprylic acid DMLGS82 Investigative Caprylic acid affects the expression of T-lymphocyte activation antigen CD86 (CD86). [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 56 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of T-lymphocyte activation antigen CD86 (CD86). [24]
------------------------------------------------------------------------------------

References

1 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
2 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
3 Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
4 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
5 Responsiveness of human monocyte-derived dendritic cells to thimerosal and mercury derivatives. Toxicol Appl Pharmacol. 2010 Jul;246(1-2):66-73. doi: 10.1016/j.taap.2010.04.007. Epub 2010 Apr 22.
6 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
7 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
8 Treatment of chronic lymphocytic leukemia with a hypomethylating agent induces expression of NXF2, an immunogenic cancer testis antigen. Clin Cancer Res. 2009 May 15;15(10):3406-15. doi: 10.1158/1078-0432.CCR-08-2099. Epub 2009 Apr 28.
9 Defective gammadelta T-cell function and granzyme B gene polymorphism in a cohort of newly diagnosed breast cancer patients. Exp Hematol. 2009 Jul;37(7):838-48. doi: 10.1016/j.exphem.2009.04.003. Epub 2009 May 14.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
11 A plasmacytoid dendritic cell (CD123+/CD11c-) based assay system to predict contact allergenicity of chemicals. Toxicology. 2009 Oct 1;264(1-2):1-9. doi: 10.1016/j.tox.2009.07.021. Epub 2009 Aug 7.
12 9-cis-Retinoic acid (9cRA), a retinoid X receptor (RXR) ligand, exerts immunosuppressive effects on dendritic cells by RXR-dependent activation: inhibition of peroxisome proliferator-activated receptor gamma blocks some of the 9cRA activities, and precludes them to mature phenotype development. J Immunol. 2007 May 15;178(10):6130-9. doi: 10.4049/jimmunol.178.10.6130.
13 Differential effects of statins on relevant functions of human monocyte-derived dendritic cells. J Leukoc Biol. 2006 Mar;79(3):529-38. doi: 10.1189/jlb.0205064. Epub 2005 Dec 30.
14 Tacrolimus ointment causes inflammatory dendritic epidermal cell depletion but no Langerhans cell apoptosis in patients with atopic dermatitis. J Allergy Clin Immunol. 2004 Jul;114(1):137-43. doi: 10.1016/j.jaci.2004.03.021.
15 Regulatory role of nitric oxide on monocyte-derived dendritic cell functions. J Interferon Cytokine Res. 2003 Aug;23(8):423-31. doi: 10.1089/107999003322277838.
16 Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.
17 Pimecrolimus leads to an apoptosis-induced depletion of T cells but not Langerhans cells in patients with atopic dermatitis. J Allergy Clin Immunol. 2005 Jun;115(6):1276-83. doi: 10.1016/j.jaci.2005.02.011.
18 Improvement of human cell line activation test (h-CLAT) using short-time exposure methods for prevention of false-negative results. J Toxicol Sci. 2018;43(3):229-240. doi: 10.2131/jts.43.229.
19 Differential regulation of resveratrol on lipopolysacchride-stimulated human macrophages with or without IFN-gamma pre-priming. Int Immunopharmacol. 2004 Jun;4(6):713-20. doi: 10.1016/j.intimp.2004.02.006.
20 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
21 Aryl hydrocarbon receptor signaling modifies Toll-like receptor-regulated responses in human dendritic cells. Arch Toxicol. 2017 May;91(5):2209-2221.
22 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
23 Chemerin promotes the pathogenesis of preeclampsia by activating CMKLR1/p-Akt/CEBP axis and inducing M1 macrophage polarization. Cell Biol Toxicol. 2022 Aug;38(4):611-628. doi: 10.1007/s10565-021-09636-7. Epub 2021 Aug 16.
24 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
25 Evaluation of CD86 expression and MHC class II molecule internalization in THP-1 human monocyte cells as predictive endpoints for contact sensitizers. Toxicol In Vitro. 2002 Dec;16(6):711-6. doi: 10.1016/s0887-2333(02)00060-7.
26 Inhibition of effects of endogenously synthesized histamine disturbs in vitro human dendritic cell differentiation. Immunol Lett. 2001 Apr 2;76(3):175-82. doi: 10.1016/s0165-2478(01)00184-5.
27 CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
28 An integrated transcriptomic- and proteomic-based approach to evaluate the human skin sensitization potential of glyphosate and its commercial agrochemical formulations. J Proteomics. 2020 Apr 15;217:103647. doi: 10.1016/j.jprot.2020.103647. Epub 2020 Jan 30.
29 Preliminary discovery of novel markers for human cell line activation test (h-CLAT). Toxicol In Vitro. 2021 Aug;74:105154. doi: 10.1016/j.tiv.2021.105154. Epub 2021 Mar 25.
30 The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
31 Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.
32 Influence of organophosphate poisoning on human dendritic cells. Chem Biol Interact. 2013 Dec 5;206(3):472-8. doi: 10.1016/j.cbi.2013.08.011. Epub 2013 Aug 29.
33 Editor's highlight: fragrance allergens linalool and limonene allylic hydroperoxides in skin allergy: Mechanisms of action focusing on transcription factor Nrf2. Toxicol Sci. 2018 Jan 1;161(1):139-148.
34 HMOX1 and NQO1 genes are upregulated in response to contact sensitizers in dendritic cells and THP-1 cell line: role of the Keap1/Nrf2 pathway. Toxicol Sci. 2009 Feb;107(2):451-60.
35 Mechanistic understanding of dendritic cell activation in skin sensitization: additional evidences to support potency classification. Toxicol Lett. 2020 Apr 1;322:50-57. doi: 10.1016/j.toxlet.2020.01.014. Epub 2020 Jan 17.
36 Expression and function of mixed lineage kinases in dendritic cells. Int Immunol. 2007 Aug;19(8):923-33. doi: 10.1093/intimm/dxm050. Epub 2007 Aug 13.
37 Sensitization effect of thimerosal is mediated in vitro via reactive oxygen species and calcium signaling. Toxicology. 2010 Jul-Aug;274(1-3):1-9. doi: 10.1016/j.tox.2010.04.016. Epub 2010 May 10.
38 M2 macrophage-derived IL6 mediates resistance of breast cancer cells to hedgehog inhibition. Toxicol Appl Pharmacol. 2019 Feb 1;364:77-82. doi: 10.1016/j.taap.2018.12.013. Epub 2018 Dec 19.
39 Synergistic effect of Nod1 and Nod2 agonists with toll-like receptor agonists on human dendritic cells to generate interleukin-12 and T helper type 1 cells. Infect Immun. 2005 Dec;73(12):7967-76. doi: 10.1128/IAI.73.12.7967-7976.2005.
40 Some non-sensitizers upregulate CD54 expression by activation of the NLRP3 inflammasome in THP-1 cells. J Toxicol Sci. 2019;44(3):213-224. doi: 10.2131/jts.44.213.