General Information of Drug Off-Target (DOT) (ID: OTJPRECT)

DOT Name Platelet-derived growth factor receptor-like protein (PDGFRL)
Synonyms PDGFR-like protein; PDGF receptor beta-like tumor suppressor
Gene Name PDGFRL
Related Disease
Adenocarcinoma ( )
Behcet disease ( )
Carcinoma ( )
Colorectal carcinoma ( )
Malignant peripheral nerve sheath tumor ( )
Neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Squamous cell carcinoma ( )
Adult hepatocellular carcinoma ( )
Advanced cancer ( )
UniProt ID
PGFRL_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13927 ; PF21339
Sequence
MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANS
APKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVK
QNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSY
FDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEH
QGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPD
VEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQ
NLQGQTTVATTVEFS
Tissue Specificity Expressed in colon, lung and liver.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenocarcinoma DIS3IHTY Strong Biomarker [1]
Behcet disease DISSYMBS Strong Genetic Variation [2]
Carcinoma DISH9F1N Strong Posttranslational Modification [3]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [4]
Malignant peripheral nerve sheath tumor DIS0JTN6 Strong Genetic Variation [5]
Neoplasm DISZKGEW Strong Biomarker [6]
Prostate cancer DISF190Y Strong Genetic Variation [7]
Prostate carcinoma DISMJPLE Strong Genetic Variation [7]
Squamous cell carcinoma DISQVIFL Strong Biomarker [1]
Adult hepatocellular carcinoma DIS6ZPAI Limited Genetic Variation [8]
Advanced cancer DISAT1Z9 Limited Biomarker [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
19 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [9]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [10]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [11]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [12]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [13]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [14]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [15]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [16]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [17]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [18]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [19]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [20]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [21]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [22]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [23]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [24]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [25]
Lithium chloride DMHYLQ2 Investigative Lithium chloride increases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [27]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE decreases the expression of Platelet-derived growth factor receptor-like protein (PDGFRL). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Platelet-derived growth factor receptor-like protein (PDGFRL). [26]
------------------------------------------------------------------------------------

References

1 Deletion of tumor suppressor genes in Chinese non-small cell lung cancer.Cancer Lett. 2002 Oct 28;184(2):189-95. doi: 10.1016/s0304-3835(02)00204-5.
2 Genetic variant on PDGFRL associated with Behet disease in Chinese Han populations.Hum Mutat. 2013 Jan;34(1):74-8. doi: 10.1002/humu.22208. Epub 2012 Oct 11.
3 Isolation of a candidate tumor suppressor gene on chromosome 8p21.3-p22 that is homologous to an extracellular domain of the PDGF receptor beta gene.Oncogene. 1995 Mar 2;10(5):891-5.
4 Expression and functional characterization of platelet-derived growth factor receptor-like gene.World J Gastroenterol. 2010 Mar 28;16(12):1465-72. doi: 10.3748/wjg.v16.i12.1465.
5 Microarray-based copy number analysis of neurofibromatosis type-1 (NF1)-associated malignant peripheral nerve sheath tumors reveals a role for Rho-GTPase pathway genes in NF1 tumorigenesis.Hum Mutat. 2012 Apr;33(4):763-76. doi: 10.1002/humu.22044. Epub 2012 Mar 5.
6 A Tumor Suppressor Gene Product, Platelet-Derived Growth Factor Receptor-Like Protein Controls Chondrocyte Proliferation and Differentiation.J Cell Biochem. 2017 Nov;118(11):4033-4044. doi: 10.1002/jcb.26059. Epub 2017 May 23.
7 PRLTS gene alterations in human prostate cancer.Jpn J Cancer Res. 1997 Apr;88(4):389-93. doi: 10.1111/j.1349-7006.1997.tb00394.x.
8 Loss of heterozygosity of chromosome 8p and 11p in the dysplastic nodule and hepatocellular carcinoma.J Gastroenterol Hepatol. 2003 Apr;18(4):430-6. doi: 10.1046/j.1440-1746.2003.02997.x.
9 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
10 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
11 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
12 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
13 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
14 Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
15 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
16 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
17 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
18 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
19 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
20 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
21 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
22 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
23 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
24 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
25 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
26 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
27 Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.