Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKXX12I)

• DOT Name: Histone chaperone ASF1B (ASF1B)
• Synonyms: Anti-silencing function protein 1 homolog B; hAsf1; hAsf1b; CCG1-interacting factor A-II; CIA-II; hCIA-II
• Gene Name: ASF1B
• Related Disease:
  Hepatocellular carcinoma
  Breast cancer
  Breast carcinoma
  Multiple sclerosis
  Prostate cancer
  Prostate carcinoma
  Acute myelogenous leukaemia
  Clear cell renal carcinoma
  Neoplasm
• UniProt ID: ASF1B_HUMAN
• PDB ID: 5BNX; 5BO0; 7V1M; 7VCQ
• Pfam ID: PF04729
• Sequence:
  MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSV
  LVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNP
  ELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTP
  IKGLGLPGCIPGLLPENSMDCI
• Function: Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Also involved in the nuclear import of the histone H3-H4 dimer together with importin-4 (IPO4): specifically recognizes and binds newly synthesized histones with the monomethylation of H3 'Lys-9' (H3K9me1) and diacetylation at 'Lys-5' and 'Lys-12' of H4 (H4K5K12ac) marks in the cytosol. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA. Required for gonad development.
• Tissue Specificity: Highly expressed in testis and at lower levels in colon, small intestine and thymus.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[3]
Prostate cancer	DISF190Y	Strong	Biomarker	[4]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[5]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[6]
Neoplasm	DISZKGEW	Limited	Altered Expression	[6]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Histone chaperone ASF1B (ASF1B).	[7]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Histone chaperone ASF1B (ASF1B).	[8]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Histone chaperone ASF1B (ASF1B).	[9]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Histone chaperone ASF1B (ASF1B).	[10]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Histone chaperone ASF1B (ASF1B).	[11]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Histone chaperone ASF1B (ASF1B).	[12]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Histone chaperone ASF1B (ASF1B).	[13]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Histone chaperone ASF1B (ASF1B).	[14]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Histone chaperone ASF1B (ASF1B).	[14]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Histone chaperone ASF1B (ASF1B).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Histone chaperone ASF1B (ASF1B).	[16]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Histone chaperone ASF1B (ASF1B).	[17]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Histone chaperone ASF1B (ASF1B).	[1]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Histone chaperone ASF1B (ASF1B).	[19]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Histone chaperone ASF1B (ASF1B).	[20]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Histone chaperone ASF1B (ASF1B).	[21]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Histone chaperone ASF1B (ASF1B).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Histone chaperone ASF1B (ASF1B).	[23]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Histone chaperone ASF1B (ASF1B).	[24]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Histone chaperone ASF1B (ASF1B).	[25]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Histone chaperone ASF1B (ASF1B).	[26]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Histone chaperone ASF1B (ASF1B).	[27]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Histone chaperone ASF1B (ASF1B).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Histone chaperone ASF1B (ASF1B).	[29]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Histone chaperone ASF1B (ASF1B).	[30]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Histone chaperone ASF1B (ASF1B).	[31]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Histone chaperone ASF1B (ASF1B).	[32]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Histone chaperone ASF1B (ASF1B).	[25]

References

• [1] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [2] Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer.EMBO J. 2011 Feb 2;30(3):480-93. doi: 10.1038/emboj.2010.335. Epub 2010 Dec 21.
• [3] Genomewide admixture study in Mexican Mestizos with multiple sclerosis.Clin Neurol Neurosurg. 2015 Mar;130:55-60. doi: 10.1016/j.clineuro.2014.11.026. Epub 2014 Dec 24.
• [4] Knockdown of anti-silencing function 1B histone chaperone induces cell apoptosis via repressing PI3K/Akt pathway in prostate cancer.Int J Oncol. 2018 Nov;53(5):2056-2066. doi: 10.3892/ijo.2018.4526. Epub 2018 Aug 16.
• [5] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [6] Anti-silencing function 1B histone chaperone promotes cell proliferation and migration via activation of the AKT pathway in clear cell renal cell carcinoma.Biochem Biophys Res Commun. 2019 Mar 26;511(1):165-172. doi: 10.1016/j.bbrc.2019.02.060. Epub 2019 Feb 15.
• [7] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [8] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [9] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [10] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [11] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [12] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [13] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [14] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [15] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [16] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [17] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [18] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [19] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [20] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [23] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [24] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [25] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [28] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [29] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [30] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [31] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [32] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.