Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMMV8ZN)

DOT Name FH2 domain-containing protein 1 (FHDC1)
Synonyms Inverted formin-1
Gene Name FHDC1
Related Disease
Endometrial cancer ( )
Endometrial carcinoma ( )
Neurofibromatosis type 1 ( )
Myasthenia gravis ( )
Venous thromboembolism ( )
UniProt ID
FHDC1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02181
Sequence
MHVMNCVSLVSDKENGNIATAPGFMIGQTPPPAPPPPPPPPPPSPPCSCSREECPSSPPP
PPPPPLPGEPPIPPPPPGLPPTTHMNGYSHLGKKKRMRSFFWKTIPEEQVRGKTNIWTLA
ARQEHHYQIDTKTIEELFGQQEDTTKSSLPRRGRTLNSSFREAREEITILDAKRSMNIGI
FLKQFKKSPRSIVEDIHQGKSEHYGSETLREFLKFLPESEEVKKLKAFSGDVSKLSLADS
FLYGLIQVPNYSLRIEAMVLKKEFLPSCSSLYTDITVLRTAIKELMSCEELHSILHLVLQ
AGNIMNAGGYAGNAVGFKLSSLLKLADTKANKPGMNLLHFVAQEAQKKDTILLNFSEKLH
HVQKTARLSLENTEAELHLLFVRTKSLKENIQRDGELCQQMEDFLQFAIEKLRELECWKQ
ELQDEAYTLIDFFCEDKKTMKLDECFQIFRDFCTKFNKAVKDNHDREAQELRQLQRLKEQ
EQKQRSWATGELGAFGRSSSENDVELLTKKGAEGLLPFLHPRPISPSSPSYRPPNTRRSR
LSLGPSADRELLTFLESSTGSPEEPNKFHSLPRSSPRQARPTIACLEPAEVRHQDSSFAH
KPQASGGQEEAPNPPSAQAHQLAAAQPENHASAFPRARRQGVSVLRKRYSEPVSLGSAQS
PPLSPLALGIKEHELVTGLAQFNLQGSQGMEETSQLTLSDFSPMELESVGHRGPQSLSAS
SSSLTPMGRDALGSLSPALEDGKAAPDEPGSAALGSVGSSDPENKDPRPLFCISDTTDCS
LTLDCSEGTDSRPRGGDPEEGGEGDGSMSSGVGEMGDSQVSSNPTSSPPGEAPAPVSVDS
EPSCKGGLPRDKPTKRKDVVAPKRGSLKEASPGASKPGSARRSQGAVAKSVRTLTASENE
SMRKVMPITKSSRGAGWRRPELSSRGPSQNPPSSTDTVWSRQNSVRRASTGAEEQRLPRG
SSGSSSTRPGRDVPLQPRGSFKKPSAKPLRNLPRQKPEENKTCRAHSEGPESPKEEPKTP
SVPSVPHELPRVPSFARNTVASSSRSMRTDLPPVAKAPGITRTVSQRQLRVKGDPEDAAP
KDSSTLRRASSARAPKKRPESAEGPSANTEAPLKARGAGERASLRRKDSSRTTLGRILNP
LRK
Function
Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation. Regulates Golgi ribbon formation. Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Endometrial cancer DISW0LMR Strong Biomarker [1]
Endometrial carcinoma DISXR5CY Strong Biomarker [1]
Neurofibromatosis type 1 DIS53JH9 moderate Biomarker [2]
Myasthenia gravis DISELRCI Limited Altered Expression [3]
Venous thromboembolism DISUR7CR Limited Biomarker [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of FH2 domain-containing protein 1 (FHDC1). [5]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of FH2 domain-containing protein 1 (FHDC1). [6]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of FH2 domain-containing protein 1 (FHDC1). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of FH2 domain-containing protein 1 (FHDC1). [8]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of FH2 domain-containing protein 1 (FHDC1). [10]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of FH2 domain-containing protein 1 (FHDC1). [11]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of FH2 domain-containing protein 1 (FHDC1). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of FH2 domain-containing protein 1 (FHDC1). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of FH2 domain-containing protein 1 (FHDC1). [12]
Microcystin-LR DMTMLRN Investigative Microcystin-LR increases the methylation of FH2 domain-containing protein 1 (FHDC1). [14]
------------------------------------------------------------------------------------

References

1 A two-step strategy for identification of plasma protein biomarkers for endometrial and ovarian cancer.Clin Proteomics. 2018 Dec 1;15:38. doi: 10.1186/s12014-018-9216-y. eCollection 2018.
2 Evaluation of quality of life in adults with neurofibromatosis 1 (NF1) using the Impact of NF1 on Quality Of Life (INF1-QOL) questionnaire.Health Qual Life Outcomes. 2017 Feb 14;15(1):34. doi: 10.1186/s12955-017-0607-y.
3 Thymoma-associated myasthenia gravis: On the search for a pathogen signature.J Autoimmun. 2014 Aug;52:29-35. doi: 10.1016/j.jaut.2013.12.018. Epub 2014 Jan 17.
4 Discordance between surgical care improvement project adherence and postoperative outcomes: implications for new Joint Commission standards.J Surg Res. 2017 May 15;212:205-213. doi: 10.1016/j.jss.2017.01.006. Epub 2017 Jan 30.
5 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
6 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
7 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
8 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
9 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
10 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
14 Gene expression network regulated by DNA methylation and microRNA during microcystin-leucine arginine induced malignant transformation in human hepatocyte L02 cells. Toxicol Lett. 2018 Jun 1;289:42-53. doi: 10.1016/j.toxlet.2018.03.003. Epub 2018 Mar 5.