Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMXJT73)

• DOT Name: Probable G-protein coupled receptor 160 (GPR160)
• Synonyms: G-protein coupled receptor GPCR1; hGPCR1
• Gene Name: GPR160
• Related Disease:
  Chronic eosinophilic leukemia
  Metastatic malignant neoplasm
  Myocardial infarction
  Prostate cancer
  Prostate carcinoma
  Testicular germ cell tumor
  Psoriasis
• UniProt ID: GP160_HUMAN
• Sequence:
  MTALSSENCSFQYQLRQTNQPLDVNYLLFLIILGKILLNILTLGMRRKNTCQNFMEYFCI
  SLAFVDLLLLVNISIILYFRDFVLLSIRFTKYHICLFTQIISFTYGFLHYPVFLTACIDY
  CLNFSKTTKLSFKCQKLFYFFTVILIWISVLAYVLGDPAIYQSLKAQNAYSRHCPFYVSI
  QSYWLSFFMVMILFVAFITCWEEVTTLVQAIRITSYMNETILYFPFSSHSSYTVRSKKIF
  LSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEMNIPWLYFVNSFLIATVYWFNCHKLN
  LKDIGLPLDPFVNWKCCFIPLTIPNLEQIEKPISIMIC
• Function: Orphan receptor.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic eosinophilic leukemia	DISAJOUO	Strong	Biomarker	[1]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[2]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[3]
Prostate cancer	DISF190Y	Strong	Altered Expression	[4]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[4]
Testicular germ cell tumor	DIS5RN24	Strong	Genetic Variation	[5]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[6]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Probable G-protein coupled receptor 160 (GPR160).	[7]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Probable G-protein coupled receptor 160 (GPR160).	[8]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Probable G-protein coupled receptor 160 (GPR160).	[9]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Probable G-protein coupled receptor 160 (GPR160).	[10]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Probable G-protein coupled receptor 160 (GPR160).	[11]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Probable G-protein coupled receptor 160 (GPR160).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Probable G-protein coupled receptor 160 (GPR160).	[13]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Probable G-protein coupled receptor 160 (GPR160).	[14]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Probable G-protein coupled receptor 160 (GPR160).	[15]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Probable G-protein coupled receptor 160 (GPR160).	[16]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Probable G-protein coupled receptor 160 (GPR160).	[18]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Probable G-protein coupled receptor 160 (GPR160).	[19]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Probable G-protein coupled receptor 160 (GPR160).	[20]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Probable G-protein coupled receptor 160 (GPR160).	[17]

References

• [1] Cloning, chromosomal localization, and RNA expression of a human beta chemokine receptor-like gene.DNA Cell Biol. 1995 Aug;14(8):673-80. doi: 10.1089/dna.1995.14.673.
• [2] Quantitative expression profiling of G-protein-coupled receptors (GPCRs) in metastatic melanoma: the constitutively active orphan GPCR GPR18 as novel drug target.Pigment Cell Melanoma Res. 2011 Feb;24(1):207-18. doi: 10.1111/j.1755-148X.2010.00781.x. Epub 2010 Oct 21.
• [3] Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
• [4] D-GPCR: a novel putative G protein-coupled receptor overexpressed in prostate cancer and prostate.Biochem Biophys Res Commun. 2004 Sep 10;322(1):239-49. doi: 10.1016/j.bbrc.2004.07.106.
• [5] Meta-analysis of five genome-wide association studies identifies multiple new loci associated with testicular germ cell tumor.Nat Genet. 2017 Jul;49(7):1141-1147. doi: 10.1038/ng.3879. Epub 2017 Jun 12.
• [6] Whole-exome SNP array identifies 15 new susceptibility loci for psoriasis.Nat Commun. 2015 Apr 9;6:6793. doi: 10.1038/ncomms7793.
• [7] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [8] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [9] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [10] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [11] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [12] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [13] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [14] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [15] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [16] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [17] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [18] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [19] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [20] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.