Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOAZLCL)

• DOT Name: Arginine/serine-rich protein 1 (RSRP1)
• Gene Name: RSRP1
• UniProt ID: RSRP1_HUMAN
• Pfam ID: PF17069
• Sequence:
  MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRSHSRVSSRFSSRSRRS
  KSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRYYRSPSRYRSRSRSRSR
  SRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSRSRTPFRLSEKDRMELLE
  IAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAKPELSEKVTEDGTRNPNEK
  PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKKSPYGLWIPI
• Function: Probably acts as a spliceosomal factor that contributes to spliceosome assembly and regulates the isoform switching of proteins such as PARP6.
• Tissue Specificity: Expressed in brain (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Arginine/serine-rich protein 1 (RSRP1) affects the response to substance of Paclitaxel.	[21]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Arginine/serine-rich protein 1 (RSRP1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Arginine/serine-rich protein 1 (RSRP1).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[9]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Arginine/serine-rich protein 1 (RSRP1).	[10]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Arginine/serine-rich protein 1 (RSRP1).	[11]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Arginine/serine-rich protein 1 (RSRP1).	[12]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[13]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Arginine/serine-rich protein 1 (RSRP1).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[14]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[15]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[16]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[17]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[18]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[19]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Arginine/serine-rich protein 1 (RSRP1).	[20]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Real-time monitoring of cisplatin-induced cell death. PLoS One. 2011;6(5):e19714. doi: 10.1371/journal.pone.0019714. Epub 2011 May 16.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [10] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [11] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [12] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [13] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [14] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [15] BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
• [16] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [17] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [18] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [19] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [20] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
• [21] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.