General Information of Drug Off-Target (DOT) (ID: OTOQQO2X)

DOT Name Melanoma-associated antigen E1 (MAGEE1)
Synonyms Alpha-dystrobrevin-associated MAGE Protein; DAMAGE; Hepatocellular carcinoma-associated protein 1; MAGE-E1 antigen
Gene Name MAGEE1
Related Disease
Infantile malignant osteopetrosis ( )
Advanced cancer ( )
Alzheimer disease ( )
Bile duct disease ( )
Bipolar disorder ( )
Colon carcinoma ( )
Disorder of orbital region ( )
Epilepsy ( )
Glaucoma/ocular hypertension ( )
Hepatocellular carcinoma ( )
Melanoma ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Amyotrophic lateral sclerosis ( )
Rheumatoid arthritis ( )
UniProt ID
MAGE1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01454
Sequence
MSLVSQNSRRRRRRVAKATAHNSSWGEMQAPNAPGLPADVPGSDVPQGPSDSQILQGLCA
SEGPSTSVLPTSAEGPSTFVPPTISEASSASGQPTISEGPGTSVLPTPSEGLSTSGPPTI
SKGLCTSVTLAASEGRNTSRPPTSSEEPSTSVPPTASEVPSTSLPPTPGEGTSTSVPPTA
YEGPSTSVVPTPDEGPSTSVLPTPGEGPGTSVPLAATEGLSTSVQATPDEGPSTSVPPTA
TEGLSTPVPPTRDEGPSTSVPATPGEGPSTSVLPAASDGQSISLVPTRGKGSSTSVPPTA
TEGLSTSVQPTAGEGSSTSVPPTPGGGLSTSVPPTATEELSTSVPPTPGEGPSTSVLPIP
GEGLSTSVPPTASDGSDTSVPPTPGEGASTLVQPTAPDGPGSSVLPNPGEGPSTLFSSSA
SVDRNPSKCSLVLPSPRVTKASVDSDSEGPKGAEGPIEFEVLRDCESPNSISIMGLNTSR
VAITLKPQDPMEQNVAELLQFLLVKDQSKYPIRESEMREYIVKEYRNQFPEILRRAAAHL
ECIFRFELRELDPEAHTYILLNKLGPVPFEGLEESPNGPKMGLLMMILGQIFLNGNQAKE
AEIWEMLWRMGVQRERRLSIFGNPKRLLSVEFVWQRYLDYRPVTDCKPVEYEFFWGPRSH
LETTKMKILKFMAKIYNKDPMDWPEKYNEALEEDAARAFAEGWQALPHFRRPFFEEAAAE
VPSPDSEVSSYSSKYAPHSWPESRLESKARKLVQLFLLMDSTKLPIPKKGILYYIGRECS
KVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEETEEIVDSPNRPGNNFLMQ
VLSFIFIMGNHARESAVWAFLRGLGVQAGRKHVITCRYLSQRYIDSLRVPDSDPVQYEFV
WGPRARLETSKMKALRYVARIHRKEPQDWPQQYREAMEDEANRADVGHRQIFVHNFR
Function
May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Infantile malignant osteopetrosis DIS8C3LZ Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Alzheimer disease DISF8S70 Strong Biomarker [3]
Bile duct disease DISPFUV2 Strong Biomarker [4]
Bipolar disorder DISAM7J2 Strong Biomarker [5]
Colon carcinoma DISJYKUO Strong Biomarker [6]
Disorder of orbital region DISH0ECJ Strong Biomarker [7]
Epilepsy DISBB28L Strong Biomarker [2]
Glaucoma/ocular hypertension DISLBXBY Strong Biomarker [2]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [6]
Melanoma DIS1RRCY Strong Altered Expression [8]
Neoplasm DISZKGEW Strong Biomarker [9]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [10]
Obesity DIS47Y1K moderate Biomarker [2]
Amyotrophic lateral sclerosis DISF7HVM Limited Biomarker [11]
Rheumatoid arthritis DISTSB4J Limited Biomarker [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Melanoma-associated antigen E1 (MAGEE1). [13]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Melanoma-associated antigen E1 (MAGEE1). [14]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Melanoma-associated antigen E1 (MAGEE1). [15]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Melanoma-associated antigen E1 (MAGEE1). [16]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Melanoma-associated antigen E1 (MAGEE1). [17]
Urethane DM7NSI0 Phase 4 Urethane affects the expression of Melanoma-associated antigen E1 (MAGEE1). [18]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Melanoma-associated antigen E1 (MAGEE1). [20]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Melanoma-associated antigen E1 (MAGEE1). [21]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Melanoma-associated antigen E1 (MAGEE1). [22]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Melanoma-associated antigen E1 (MAGEE1). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Melanoma-associated antigen E1 (MAGEE1). [19]
------------------------------------------------------------------------------------

References

1 The determination of osteopetrotic phenotypes by selective inactivation of red cell carbonic anhydrase isoenzymes.Clin Chim Acta. 1985 Nov 15;152(3):347-54. doi: 10.1016/0009-8981(85)90110-x.
2 Design, synthesis and biological evaluation of novel ureido benzenesulfonamides incorporating 1,3,5-triazine moieties as potent carbonic anhydrase IX inhibitors.Bioorg Chem. 2019 Feb;82:117-122. doi: 10.1016/j.bioorg.2018.10.005. Epub 2018 Oct 5.
3 Novel sulfamate derivatives of menthol: Synthesis, characterization, and cholinesterases and carbonic anhydrase enzymes inhibition properties.Arch Pharm (Weinheim). 2018 Nov;351(11):e1800209. doi: 10.1002/ardp.201800209. Epub 2018 Sep 26.
4 Embracing the Dark Side: Computational Approaches to Unveil the Functionality of Genes Lacking Biological Annotation in Drug-Induced Liver Injury.Front Genet. 2018 Nov 20;9:527. doi: 10.3389/fgene.2018.00527. eCollection 2018.
5 Increased DNA and RNA damage by oxidation in patients with bipolar I disorder.Transl Psychiatry. 2016 Aug 9;6(8):e867. doi: 10.1038/tp.2016.141.
6 Enhancement of radiation-induced DNA double-strand breaks and micronuclei in human colon carcinoma cells by N-methylformamide.Radiat Res. 1989 Jul;119(1):166-75.
7 Discovery of curcumin inspired sulfonamide derivatives as a new class of carbonic anhydrase isoforms I, II, IX, and XII inhibitors.J Enzyme Inhib Med Chem. 2017 Dec;32(1):1274-1281. doi: 10.1080/14756366.2017.1380638.
8 Antitumor activity of an adenovirus harboring human IL-24 in colon cancer.Mol Biol Rep. 2011 Jan;38(1):395-401. doi: 10.1007/s11033-010-0121-3. Epub 2010 Mar 31.
9 Direct and straightforward access to substituted alkyl selenols as novel carbonic anhydrase inhibitors.Eur J Med Chem. 2020 Jan 1;185:111811. doi: 10.1016/j.ejmech.2019.111811. Epub 2019 Oct 30.
10 Genetic association analysis of 13 nuclear-encoded mitochondrial candidate genes with type II diabetes mellitus: the DAMAGE study.Eur J Hum Genet. 2009 Aug;17(8):1056-62. doi: 10.1038/ejhg.2009.4. Epub 2009 Feb 11.
11 Synthesis and human/bacterial carbonic anhydrase inhibition with a series of sulfonamides incorporating phthalimido moieties.Bioorg Med Chem. 2017 Apr 15;25(8):2524-2529. doi: 10.1016/j.bmc.2017.03.017. Epub 2017 Mar 9.
12 Synovial membrane cytokine expression is predictive of joint damage progression in rheumatoid arthritis: a two-year prospective study (the DAMAGE study cohort).Arthritis Rheum. 2006 Apr;54(4):1122-31. doi: 10.1002/art.21749.
13 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
14 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
15 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
16 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
17 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
18 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
19 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
20 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
21 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
22 Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.
23 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.