Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSP64PQ)

• DOT Name: Inhibin beta A chain (INHBA)
• Synonyms: Activin beta-A chain; Erythroid differentiation protein; EDF
• Gene Name: INHBA
• UniProt ID: INHBA_HUMAN
• PDB ID: 1NYS; 1NYU; 1S4Y; 2ARP; 2ARV; 2B0U; 2P6A; 3B4V; 4MID; 5HLY; 5HLZ; 6Y6N; 6Y6O; 7OLY; 7U5P
• Pfam ID: PF00019 ; PF00688
• Sequence:
  MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKK
  HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
  SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
  HPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDV
  RIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
  EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAG
  TSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
  EECGCS
• Function: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  TGF-beta sig.ling pathway (hsa04350)
  Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
• Reactome Pathway:
  Signaling by BMP (R-HSA-201451)
  Glycoprotein hormones (R-HSA-209822)
  Antagonism of Activin by Follistatin (R-HSA-2473224)
  Signaling by Activin (R-HSA-1502540)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Inhibin beta A chain (INHBA) affects the response to substance of Temozolomide.	[36]
DTI-015	DMXZRW0	Approved	Inhibin beta A chain (INHBA) affects the response to substance of DTI-015.	[36]
Topotecan	DMP6G8T	Approved	Inhibin beta A chain (INHBA) affects the response to substance of Topotecan.	[37]
Vinblastine	DM5TVS3	Approved	Inhibin beta A chain (INHBA) affects the response to substance of Vinblastine.	[37]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Inhibin beta A chain (INHBA).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Inhibin beta A chain (INHBA).	[22]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Inhibin beta A chain (INHBA).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Inhibin beta A chain (INHBA).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Inhibin beta A chain (INHBA).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Inhibin beta A chain (INHBA).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Inhibin beta A chain (INHBA).	[6]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Inhibin beta A chain (INHBA).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Inhibin beta A chain (INHBA).	[8]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Inhibin beta A chain (INHBA).	[9]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Inhibin beta A chain (INHBA).	[10]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Inhibin beta A chain (INHBA).	[11]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Inhibin beta A chain (INHBA).	[12]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Inhibin beta A chain (INHBA).	[13]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Inhibin beta A chain (INHBA).	[14]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Inhibin beta A chain (INHBA).	[15]
Busulfan	DMXYJ9C	Approved	Busulfan increases the expression of Inhibin beta A chain (INHBA).	[16]
Isoflavone	DM7U58J	Phase 4	Isoflavone decreases the expression of Inhibin beta A chain (INHBA).	[17]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Inhibin beta A chain (INHBA).	[18]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Inhibin beta A chain (INHBA).	[19]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Inhibin beta A chain (INHBA).	[20]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Inhibin beta A chain (INHBA).	[18]
ANW-32821	DMMJOZD	Phase 2	ANW-32821 increases the expression of Inhibin beta A chain (INHBA).	[21]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Inhibin beta A chain (INHBA).	[23]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Inhibin beta A chain (INHBA).	[24]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Inhibin beta A chain (INHBA).	[25]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Inhibin beta A chain (INHBA).	[26]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Inhibin beta A chain (INHBA).	[27]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Inhibin beta A chain (INHBA).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Inhibin beta A chain (INHBA).	[25]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Inhibin beta A chain (INHBA).	[29]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Inhibin beta A chain (INHBA).	[30]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Inhibin beta A chain (INHBA).	[31]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Inhibin beta A chain (INHBA).	[32]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Inhibin beta A chain (INHBA).	[33]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Inhibin beta A chain (INHBA).	[34]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
[3H]cAMP	DMZRQU7	Investigative	[3H]cAMP increases the secretion of Inhibin beta A chain (INHBA).	[35]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Activin-A and myostatin response and steroid regulation in human myometrium: disruption of their signalling in uterine fibroid. J Clin Endocrinol Metab. 2011 Mar;96(3):755-65. doi: 10.1210/jc.2010-0501. Epub 2010 Dec 22.
• [7] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [8] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [9] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [10] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [11] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [12] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [13] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [14] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [15] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [16] Busulfan induces activin A expression in vitro and in vivo: a possible link to venous occlusive disease. Clin Pharmacol Ther. 2003 Sep;74(3):264-74.
• [17] Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
• [18] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [19] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [20] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [21] Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses. J Biol Chem. 2015 Oct 16;290(42):25322-32. doi: 10.1074/jbc.M115.645234. Epub 2015 Aug 20.
• [22] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [23] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [24] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [25] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [26] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [27] Cadmium induces transcription independently of intracellular calcium mobilization. PLoS One. 2011;6(6):e20542.
• [28] Transcriptomic?pathway?and?benchmark dose analysis of Bisphenol A, Bisphenol S, Bisphenol F, and 3,3',5,5'-Tetrabromobisphenol A in H9 human embryonic stem cells. Toxicol In Vitro. 2021 Apr;72:105097. doi: 10.1016/j.tiv.2021.105097. Epub 2021 Jan 18.
• [29] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [30] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [31] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [32] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [33] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [34] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [35] Interleukin 11 and activin A synergise to regulate progesterone-induced but not cAMP-induced decidualization. J Reprod Immunol. 2010 Mar;84(2):124-32. doi: 10.1016/j.jri.2009.12.001. Epub 2010 Jan 13.
• [36] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
• [37] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.