General Information of Drug Off-Target (DOT) (ID: OTUYTF4I)

DOT Name Rho GTPase-activating protein 31 (ARHGAP31)
Synonyms Cdc42 GTPase-activating protein
Gene Name ARHGAP31
Related Disease
Adams-Oliver syndrome 1 ( )
Autoimmune disease ( )
Autoimmune disease, susceptibility to, 6 ( )
Coeliac disease ( )
Corpus callosum, agenesis of ( )
Multiple sclerosis ( )
Primary biliary cholangitis ( )
STAT3-related early-onset multisystem autoimmune disease ( )
Systemic sclerosis ( )
Asthma ( )
Immune system disorder ( )
Adams-Oliver syndrome ( )
Breast cancer ( )
Breast carcinoma ( )
Acute myelogenous leukaemia ( )
Aplasia cutis congenita ( )
Coronary heart disease ( )
UniProt ID
RHG31_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00620
Sequence
MKNKGAKQKLKRKGAASAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSGV
TSNIQRLRQEFGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVS
HCPEEGQLARIQNVIQELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLR
SKEIEATGCNGDAAFLAVRVQQVVIEFILNHVDQIFNNGAPGSLENDENRPIMKSLTLPA
LSLPMKLVSLEEAQARSLATNHPARKERRENSLPEIVPPMGTLFHTVLELPDNKRKLSSK
SKKWKSIFNLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPVEGKET
KGNFNRTVTTGGFFIPATKMHSTGTGSSCDLTKQEGEWGQEGMPPGAEGGFDVSSDRSHL
QGAQARPPPEQLKVFRPVEDPESEQTAPKMLGMFYTSNDSPSKSVFTSSLFQMEPSPRNQ
RKALNISEPFAVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFHGSESGGWPEEEK
PLGAETSAASVPKKAGLEDAKAVPEAPGTVECSKGLSQEPGAHLEEKKTPESSLSSQHLN
ELEKRPNPEKVVEEGREAGEMESSTLQESPRARAEAVLLHEMDEDDLANALIWPEIQQEL
KIIESEEELSSLPPPALKTSPIQPILESSLGPFIPSEPPGSLPCGSFPAPVSTPLEVWTR
DPANQSTQGASTAASREKPEPEQGLHPDLASLAPLEIVPFEKASPQATVEVGGPGNLSPP
LPPAPPPPTPLEESTPVLLSKGGPEREDSSRKLRTDLYIDQLKSQDSPEISSLCQGEEAT
PRHSDKQNSKNAASEGKGCGFPSPTREVEIVSQEEEDVTHSVQEPSDCDEDDTVTDIAQH
GLEMVEPWEEPQWVTSPLHSPTLKDAHKAQVQGLQGHQLEKRLSHRPSLRQSHSLDSKPT
VKSQWTLEVPSSSSCANLETERNSDPLQPQAPRREITGWDEKALRSFREFSGLKGAEAPP
NQKGPSGVQPNPAETSPISLAEGKELGTHLGHSSPQIRQGGVPGPESSKESSPSVQDSTS
PGEHPAKLQLKSTECGPPKGKNRPSSLNLDPAIPIADLFWFENVASFSSPGMQVSEPGDP
KVTWMTSSYCKADPWRVYSQDPQDLDIVAHALTGRRNSAPVSVSAVRTSFMVKMCQARAV
PVIPPKIQYTQIPQPLPSQSSGENGVQPLERSQEGPSSTSGTTQKPAKDDSPSSLESSKE
EKPKQDPGAIKSSPVDATAPCMCEGPTLSPEPGSSNLLSTQDAVVQCRKRMSETEPSGDN
LLSSKLERPSGGSKPFHRSRPGRPQSLILFSPPFPIMDHLPPSSTVTDSKVLLSPIRSPT
QTVSPGLLCGELAENTWVTPEGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVILDGRSG
RQIE
Function Functions as a GTPase-activating protein (GAP) for RAC1 and CDC42. Required for cell spreading, polarized lamellipodia formation and cell migration.
Reactome Pathway
CDC42 GTPase cycle (R-HSA-9013148 )
RAC1 GTPase cycle (R-HSA-9013149 )
RHOU GTPase cycle (R-HSA-9013420 )
RHOA GTPase cycle (R-HSA-8980692 )

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adams-Oliver syndrome 1 DISC3I62 Strong Autosomal dominant [1]
Autoimmune disease DISORMTM Strong Genetic Variation [2]
Autoimmune disease, susceptibility to, 6 DISHNUXI Strong Genetic Variation [2]
Coeliac disease DISIY60C Strong Genetic Variation [3]
Corpus callosum, agenesis of DISO9P40 Strong Genetic Variation [4]
Multiple sclerosis DISB2WZI Strong Genetic Variation [5]
Primary biliary cholangitis DIS43E0O Strong Genetic Variation [6]
STAT3-related early-onset multisystem autoimmune disease DISAXTN7 Strong Genetic Variation [2]
Systemic sclerosis DISF44L6 Strong Genetic Variation [7]
Asthma DISW9QNS moderate Genetic Variation [8]
Immune system disorder DISAEGPH moderate Genetic Variation [9]
Adams-Oliver syndrome DISQO525 Supportive Autosomal dominant [10]
Breast cancer DIS7DPX1 Disputed Biomarker [11]
Breast carcinoma DIS2UE88 Disputed Biomarker [11]
Acute myelogenous leukaemia DISCSPTN Limited Genetic Variation [12]
Aplasia cutis congenita DISMDAYM Limited Genetic Variation [4]
Coronary heart disease DIS5OIP1 Limited Biomarker [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Rho GTPase-activating protein 31 (ARHGAP31). [14]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Rho GTPase-activating protein 31 (ARHGAP31). [15]
Panobinostat DM58WKG Approved Panobinostat affects the expression of Rho GTPase-activating protein 31 (ARHGAP31). [17]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Rho GTPase-activating protein 31 (ARHGAP31). [18]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Rho GTPase-activating protein 31 (ARHGAP31). [19]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Rho GTPase-activating protein 31 (ARHGAP31). [16]
------------------------------------------------------------------------------------

References

1 Autosomal dominant inheritance of scalp defects with ectrodactyly. Am J Med Genet. 1979;3(1):35-41. doi: 10.1002/ajmg.1320030109.
2 Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
3 Dense genotyping identifies and localizes multiple common and rare variant association signals in celiac disease.Nat Genet. 2011 Nov 6;43(12):1193-201. doi: 10.1038/ng.998.
4 Elucidating the genetic architecture of Adams-Oliver syndrome in a large European cohort.Hum Mutat. 2018 Sep;39(9):1246-1261. doi: 10.1002/humu.23567. Epub 2018 Jul 4.
5 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.Ann Neurol. 2011 Dec;70(6):897-912. doi: 10.1002/ana.22609.
6 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.Nat Genet. 2011 Mar 13;43(4):329-32. doi: 10.1038/ng.789.
7 GWAS for systemic sclerosis identifies multiple risk loci and highlights fibrotic and vasculopathy pathways.Nat Commun. 2019 Oct 31;10(1):4955. doi: 10.1038/s41467-019-12760-y.
8 Association between ORMDL3, IL1RL1 and a deletion on chromosome 17q21 with asthma risk in Australia.Eur J Hum Genet. 2011 Apr;19(4):458-64. doi: 10.1038/ejhg.2010.191. Epub 2010 Dec 8.
9 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.PLoS Genet. 2011 Feb;7(2):e1002004. doi: 10.1371/journal.pgen.1002004. Epub 2011 Feb 24.
10 Gain-of-function mutations of ARHGAP31, a Cdc42/Rac1 GTPase regulator, cause syndromic cutis aplasia and limb anomalies. Am J Hum Genet. 2011 May 13;88(5):574-85. doi: 10.1016/j.ajhg.2011.04.013.
11 CdGAP/ARHGAP31 is regulated by RSK phosphorylation and binding to 14-3-3 adaptor protein.Oncotarget. 2018 Jan 10;9(14):11646-11664. doi: 10.18632/oncotarget.24126. eCollection 2018 Feb 20.
12 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
13 Validation study of genetic associations with coronary artery disease on chromosome 3q13-21 and potential effect modification by smoking.Ann Hum Genet. 2009 Nov;73(Pt 6):551-8. doi: 10.1111/j.1469-1809.2009.00540.x. Epub 2009 Aug 25.
14 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
15 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
16 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
17 The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
18 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
19 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.