Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV2F04G)

• DOT Name: NEDD4-binding protein 2-like 2 (N4BP2L2)
• Synonyms: Phosphonoformate immuno-associated protein 5
• Gene Name: N4BP2L2
• Related Disease:
  Hepatocellular carcinoma
  Leukopenia
  Skin disease
  Coronary heart disease
• UniProt ID: N42L2_HUMAN
• Pfam ID: PF13671
• Sequence:
  MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTII
  DVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEARPPLVSADDEIYSTS
  KAFIGPIYKPPEKKKRNEGRNEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIE
  ELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPDEEKKDLSNKAMPSHCDYQQNLG
  NEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGPPLPSLNYHLNIQRFSGPPNP
  PSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRY
  VSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSR
  ILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNI
  QAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMS
  ISIVMNSVEPSHKSTQRPPPPQGRQRWGGSLGSHNRVCVTNNH

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
Leukopenia	DISJMBMM	Strong	Biomarker	[2]
Skin disease	DISDW8R6	Strong	Biomarker	[3]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[4]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of NEDD4-binding protein 2-like 2 (N4BP2L2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of NEDD4-binding protein 2-like 2 (N4BP2L2).	[19]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of NEDD4-binding protein 2-like 2 (N4BP2L2).	[22]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[7]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[8]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[11]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[12]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[13]
Selenium	DM25CGV	Approved	Selenium decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[14]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[16]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[17]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[18]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[20]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[21]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[23]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[24]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[25]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of NEDD4-binding protein 2-like 2 (N4BP2L2).	[17]

References

• [1] MRNA expression of genes altered by 5-azacytidine treatment in cancer cell lines is associated with clinicopathological parameters of human cancers.J Cancer Res Clin Oncol. 2001 Dec;127(12):697-706. doi: 10.1007/s004320100284.
• [2] Contributions to neutropenia from PFAAP5 (N4BP2L2), a novel protein mediating transcriptional repressor cooperation between Gfi1 and neutrophil elastase.Mol Cell Biol. 2009 Aug;29(16):4394-405. doi: 10.1128/MCB.00596-09. Epub 2009 Jun 8.
• [3] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [4] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [7] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [8] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [9] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [10] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [13] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [14] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [15] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [16] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [17] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [18] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [21] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [22] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [23] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [24] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [25] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.