Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXLM86J)

DOT Name Deuterosome assembly protein 1 (DEUP1)
Synonyms Coiled-coil domain-containing protein 67
Gene Name DEUP1
Related Disease
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Liver cancer ( )
Neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Stomach cancer ( )
Thyroid gland papillary carcinoma ( )
Advanced cancer ( )
Glioblastoma multiforme ( )
Non-small-cell lung cancer ( )
UniProt ID
DEUP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF17045
Sequence
MENQAHNTMGTSPCEAELQELMEQIDIMVSNKKMDWERKMRALETRLDLRDQELANAQTC
LDQKGQEVGLLRQKLDSLEKCNLAMTQNYEGQLQSLKAQFSKLTNNFEKLRLHQMKQNKV
PRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQTHLISLDAQQKLLSEKCNQ
FQKQAQSYQTQLNGKKQCLEDSSSEIPRLICDPDPNCEINERDEFIIEKLKSAVNEIALS
RNKLQDENQKLLQELKMYQRQCQAMEAGLSEVKSELQSRDDLLRIIEMERLQLHRELLKI
GECQNAQGNKTRLESSYLPSIKEPERKIKELFSVMQDQPNHEKELNKIRSQLQQVEEYHN
SEQERMRNEISDLTEELHQKEITIATVTKKAALLEKQLKMELEIKEKMLAKQKVSDMKYK
AVRTENTHLKGMMGDLDPGEYMSMDFTNREQSRHTSINKLQYENERLRNDLAKLHVNGKS
TWTNQNTYEETGRYAYQSQIKVEQNEERLSHDCEPNRSTMPPLPPSTFQAKEMTSPLVSD
DDVFPLSPPDMSFPASLAAQHFLLEEEKRAKELEKLLNTHIDELQRHTEFTLNKYSKLKQ
NRHI
Function
Key structural component of the deuterosome, a structure that promotes de novo centriole amplification in multiciliated cells. Deuterosome-mediated centriole amplification occurs in terminally differentiated multiciliated cells and can generate more than 100 centrioles. Probably sufficient for the specification and formation of the deuterosome inner core. Interacts with CEP152 and recruits PLK4 to activate centriole biogenesis.

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Thyroid cancer DIS3VLDH Definitive Altered Expression [1]
Thyroid gland carcinoma DISMNGZ0 Definitive Altered Expression [1]
Thyroid tumor DISLVKMD Definitive Altered Expression [1]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Posttranslational Modification [2]
Gastric cancer DISXGOUK Strong Genetic Variation [3]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [2]
Liver cancer DISDE4BI Strong Posttranslational Modification [2]
Neoplasm DISZKGEW Strong Altered Expression [2]
Prostate cancer DISF190Y Strong Biomarker [4]
Prostate carcinoma DISMJPLE Strong Biomarker [4]
Stomach cancer DISKIJSX Strong Genetic Variation [3]
Thyroid gland papillary carcinoma DIS48YMM Strong Biomarker [5]
Advanced cancer DISAT1Z9 Limited Biomarker [6]
Glioblastoma multiforme DISK8246 Limited Biomarker [7]
Non-small-cell lung cancer DIS5Y6R9 Limited Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Deuterosome assembly protein 1 (DEUP1). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Deuterosome assembly protein 1 (DEUP1). [11]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Triclosan DMZUR4N Approved Triclosan decreases the expression of Deuterosome assembly protein 1 (DEUP1). [9]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Deuterosome assembly protein 1 (DEUP1). [10]
------------------------------------------------------------------------------------

References

1 Generation and identification of a thyroid cancer cell line with stable expression of CCDC67 and luciferase reporter genes.Oncol Lett. 2019 Nov;18(5):4495-4502. doi: 10.3892/ol.2019.10839. Epub 2019 Sep 10.
2 Clinical significance of aberrant DEUP1 promoter methylation in hepatocellular carcinoma.Oncol Lett. 2019 Aug;18(2):1356-1364. doi: 10.3892/ol.2019.10421. Epub 2019 May 30.
3 Epigenetic alteration of CCDC67 and its tumor suppressor function in gastric cancer.Carcinogenesis. 2012 Aug;33(8):1494-501. doi: 10.1093/carcin/bgs178. Epub 2012 May 18.
4 Targeting genomic rearrangements in tumor cells through Cas9-mediated insertion of a suicide gene.Nat Biotechnol. 2017 Jun;35(6):543-550. doi: 10.1038/nbt.3843. Epub 2017 May 1.
5 MiR-96-5p promotes the proliferation, invasion and metastasis of papillary thyroid carcinoma through down-regulating CCDC67.Eur Rev Med Pharmacol Sci. 2019 Apr;23(8):3421-3430. doi: 10.26355/eurrev_201904_17706.
6 Characterization of the novel tumor-suppressor gene CCDC67 in papillary thyroid carcinoma.Oncotarget. 2016 Feb 2;7(5):5830-41. doi: 10.18632/oncotarget.6709.
7 Identification of recurrent fusion genes across multiple cancer types.Sci Rep. 2019 Jan 31;9(1):1074. doi: 10.1038/s41598-019-38550-6.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
10 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.