Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY6ZHVA)

• DOT Name: Ral guanine nucleotide dissociation stimulator-like 1 (RGL1)
• Synonyms: RalGDS-like 1
• Gene Name: RGL1
• Related Disease:
  Adenocarcinoma
  Lung cancer
  Lung carcinoma
  Squamous cell carcinoma
• UniProt ID: RGL1_HUMAN
• PDB ID: 7SCW; 7SCX
• Pfam ID: PF00788 ; PF00617 ; PF00618
• Sequence:
  MKLLWQAKMSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQ
  YETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNL
  TSPNCEEDGSQSSSESKMVIRNAIASILRAWLDQCAEDFREPPHFPCLQKLLDYLTRMMP
  GSDPERRAQNLLEQFQKQEVETDNGLPNTISFSLEEEEELEGGESAEFTCFSEDLVAEQL
  TYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTILGGKEL
  KTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEE
  LSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYL
  GTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDQKFIQWF
  QRQQLLTEEESYALSCEIEAAADASTTSPKPRKSMVKRLSLLFLGSDMITSPTPTKEQPK
  STASGSSGESMDSVSVSSCESNHSEAEEGSITPMDTPDEPQKKLSESSSSCSSIHSMDTN
  SSGMSSLINPLSSPPSCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNN
  GNMYKSIMLTSQDKTPAVIQRAMLKHNLDSDPAEEYELVQVISEDKELVIPDSANVFYAM
  NSQVNFDFILRKKNSMEEQVKLRSRTSLTLPRTAKRGCWSNRHSKITL
• Function: Probable guanine nucleotide exchange factor.
• Tissue Specificity: Expressed in a wide variety of tissues with strong expression being seen in the heart, brain, kidney, spleen and testis.
• KEGG Pathway: Ras sig.ling pathway (hsa04014)
• Reactome Pathway:
  RAF/MAP kinase cascade (R-HSA-5673001)
  PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[1]
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[1]

33 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[11]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[6]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[12]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[9]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[13]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[15]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[16]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[17]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[18]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[19]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[20]
MGCD-0103	DM726HX	Phase 2	MGCD-0103 increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[13]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[21]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[22]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[23]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[24]
Tacedinaline	DM1Z74X	Discontinued in Phase 2	Tacedinaline increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[13]
Scriptaid	DM9JZ21	Preclinical	Scriptaid increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[13]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[25]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[15]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[26]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[27]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[13]
Octanedioic acid bis-hydroxyamide	DMJNQ9K	Investigative	Octanedioic acid bis-hydroxyamide increases the expression of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[13]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[14]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Ral guanine nucleotide dissociation stimulator-like 1 (RGL1).	[14]

References

• [1] Genetic interaction analysis among oncogenesis-related genes revealed novel genes and networks in lung cancer development.Oncotarget. 2019 Mar 5;10(19):1760-1774. doi: 10.18632/oncotarget.26678. eCollection 2019 Mar 5.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [11] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [12] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [13] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [14] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [15] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [16] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [17] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [20] Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
• [21] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [22] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [23] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [24] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [25] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [26] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [27] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.