Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZS877V)

• DOT Name: Annexin A5 (ANXA5)
• Synonyms: Anchorin CII; Annexin V; Annexin-5; Calphobindin I; CPB-I; Endonexin II; Lipocortin V; Placental anticoagulant protein 4; PP4; Placental anticoagulant protein I; PAP-I; Thromboplastin inhibitor; Vascular anticoagulant-alpha; VAC-alpha
• Gene Name: ANXA5
• Related Disease: Pregnancy loss, recurrent, susceptibility to, 3
• UniProt ID: ANXA5_HUMAN
• PDB ID: 1ANW; 1ANX; 1AVH; 1AVR; 1HAK; 1HVD; 1HVE; 1HVF; 1HVG; 1SAV; 2XO2; 2XO3; 6K22; 6K25; 8GYC; 8H0J; 8H9Z
• Pfam ID: PF00191
• Sequence:
  MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTL
  FGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
  ELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALF
  QAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAV
  VKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI
  KGDTSGDYKKALLLLCGEDD
• Function: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
• Reactome Pathway: Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Pregnancy loss, recurrent, susceptibility to, 3	DISLMQNF	Disputed	Unknown	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Annexin A5 (ANXA5).	[2]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Annexin A5 (ANXA5).	[23]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Annexin A5 (ANXA5).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Annexin A5 (ANXA5).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Annexin A5 (ANXA5).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Annexin A5 (ANXA5).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Annexin A5 (ANXA5).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Annexin A5 (ANXA5).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Annexin A5 (ANXA5).	[9]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Annexin A5 (ANXA5).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Annexin A5 (ANXA5).	[11]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Annexin A5 (ANXA5).	[12]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Annexin A5 (ANXA5).	[13]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Annexin A5 (ANXA5).	[14]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Annexin A5 (ANXA5).	[15]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Annexin A5 (ANXA5).	[16]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Annexin A5 (ANXA5).	[17]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Annexin A5 (ANXA5).	[14]
Nitric Oxide	DM1RBYG	Approved	Nitric Oxide increases the expression of Annexin A5 (ANXA5).	[18]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Annexin A5 (ANXA5).	[19]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Annexin A5 (ANXA5).	[20]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Annexin A5 (ANXA5).	[21]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Annexin A5 (ANXA5).	[22]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Annexin A5 (ANXA5).	[24]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Annexin A5 (ANXA5).	[25]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Annexin A5 (ANXA5).	[26]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Annexin A5 (ANXA5).	[27]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Annexin A5 (ANXA5).	[28]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Annexin A5 (ANXA5).	[29]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Annexin A5 (ANXA5).	[30]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl decreases the expression of Annexin A5 (ANXA5).	[32]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the cleavage of Annexin A5 (ANXA5).	[31]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [5] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [10] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [11] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [12] Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
• [13] Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
• [14] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [15] Nonsteroidal anti-inflammatory drugs induced endothelial apoptosis by perturbing peroxisome proliferator-activated receptor-delta transcriptional pathway. Mol Pharmacol. 2008 Nov;74(5):1399-406. doi: 10.1124/mol.108.049569. Epub 2008 Aug 4.
• [16] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [17] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [18] Nitric oxide-induced apoptosis in lymphoblastoid and fibroblast cells dependent on the phosphorylation and activation of p53. Cancer Res. 2005 Jul 15;65(14):6097-104. doi: 10.1158/0008-5472.CAN-04-4254.
• [19] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [20] Analysis of resveratrol-induced apoptosis in human B-cell chronic leukaemia. Br J Haematol. 2002 Jun;117(4):842-51. doi: 10.1046/j.1365-2141.2002.03520.x.
• [21] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [22] JQ1 suppresses tumor growth through downregulating LDHA in ovarian cancer. Oncotarget. 2015 Mar 30;6(9):6915-30. doi: 10.18632/oncotarget.3126.
• [23] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [24] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [25] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [26] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [27] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [28] Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
• [29] Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
• [30] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [31] Rosiglitazone inhibits chlorpyrifos-induced apoptosis via modulation of the oxidative stress and inflammatory response in SH-SY5Y cells. Toxicol Appl Pharmacol. 2014 Jul 15;278(2):159-71.
• [32] Novel insights into the combined effect of triorganotin compounds and all-trans retinoic acid on expression of selected proteins associated with tumor progression in breast cancer cell line MDA-MB-231: Proteomic approach. Gen Physiol Biophys. 2019 Mar;38(2):135-144. doi: 10.4149/gpb_2018042. Epub 2019 Feb 26.