Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZTZI7P)

• DOT Name: Myeloid-associated differentiation marker (MYADM)
• Synonyms: Protein SB135
• Gene Name: MYADM
• Related Disease:
  Hepatocellular carcinoma
  Smith-McCort dysplasia 1
  Lymphoid leukemia
  T-cell leukaemia
• UniProt ID: MYADM_HUMAN
• Pfam ID: PF01284
• Sequence:
  MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAW
  TGSMGNWSMFTWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIY
  PTTYVQFLSHGRSRDHAIAATFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLE
  TFVACIIFAFISDPNLYQHQPALEWCVAVYAICFILAAIAILLNLGECTNVLPIPFPSFL
  SGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCSRSHAYYVCAWDRRLAVAILT
  AINLLAYVADLVHSAHLVFVKV
• Tissue Specificity: Widely expressed. Not detected in thymus.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
Smith-McCort dysplasia 1	DIS8072R	Strong	Biomarker	[2]
Lymphoid leukemia	DIS65TYQ	Limited	Altered Expression	[3]
T-cell leukaemia	DISJ6YIF	Limited	Altered Expression	[3]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Myeloid-associated differentiation marker (MYADM).	[4]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Myeloid-associated differentiation marker (MYADM).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Myeloid-associated differentiation marker (MYADM).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Myeloid-associated differentiation marker (MYADM).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Myeloid-associated differentiation marker (MYADM).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Myeloid-associated differentiation marker (MYADM).	[9]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Myeloid-associated differentiation marker (MYADM).	[10]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Myeloid-associated differentiation marker (MYADM).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Myeloid-associated differentiation marker (MYADM).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Myeloid-associated differentiation marker (MYADM).	[13]
Marinol	DM70IK5	Approved	Marinol increases the expression of Myeloid-associated differentiation marker (MYADM).	[14]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Myeloid-associated differentiation marker (MYADM).	[15]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Myeloid-associated differentiation marker (MYADM).	[12]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Myeloid-associated differentiation marker (MYADM).	[16]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Myeloid-associated differentiation marker (MYADM).	[17]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Myeloid-associated differentiation marker (MYADM).	[18]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Myeloid-associated differentiation marker (MYADM).	[20]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Myeloid-associated differentiation marker (MYADM).	[21]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Myeloid-associated differentiation marker (MYADM).	[22]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Myeloid-associated differentiation marker (MYADM).	[19]

References

• [1] A quantitative proteomic approach for identification of potential biomarkers in hepatocellular carcinoma.J Proteome Res. 2008 Oct;7(10):4289-98. doi: 10.1021/pr800197z. Epub 2008 Aug 21.
• [2] Oncological miR-182-3p, a Novel Smooth Muscle Cell Phenotype Modulator, Evidences From Model Rats and Patients.Arterioscler Thromb Vasc Biol. 2016 Jul;36(7):1386-97. doi: 10.1161/ATVBAHA.115.307412. Epub 2016 May 19.
• [3] Membrane protein hMYADM preferentially expressed in myeloid cells is up-regulated during differentiation of stem cells and myeloid leukemia cells.Life Sci. 2007 Jan 9;80(5):420-9. doi: 10.1016/j.lfs.2006.09.043. Epub 2006 Oct 14.
• [4] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [7] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [8] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [9] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [12] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [13] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [14] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [15] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [16] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [17] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [21] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [22] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.