Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTCSGPB)

• DTP Name: Multidrug resistance-associated protein 4 (ABCC4)
• Gene Name: ABCC4
• UniProt ID: O15439 (MRP4_HUMAN)
• VARIDT ID: DTD0015
• Synonyms: ABCC4; ATP-binding cassette sub-family C member 4; MOAT-B; MOATB; MRP/cMOAT-related ABC transporter; MRP4; Multi-specific organic anion transporter B
• DTP Family:
  ATP-Binding Cassette (ABC) Superfamily
  Drug Conjugate Transporter (DCT) Family (ABCC)
• Tissue Specificity: Widely expressed, with particularly highlevels in prostate, but is barely detectable in liver.
• Sequence:
  MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEEL
  QGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYF
  ENYDPMDSVALNTAYAYATVLTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALR
  LSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAG
  MAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
  NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGA
  VRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
  KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQ
  QPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQK
  ARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
  SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVW
  SQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILL
  NTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVATVLFGI
  ARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF
  LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
  FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFV
  IIVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLE
  KEAPWEYQKRPPPAWPHEGVIIFDNVNFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAG
  KSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNE
  HTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
  DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV
  LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTI
  FETAL
• Function: This transporter may be an organic anion pump relevant to cellular detoxification.
• Endogenous Substrate(s): 9-(2-phosphonylmethyoxyethyl)adenine; Cyclic nucleotides; Estradiol 17-beta-D-glucuronides; Leukotrienes; Nucleotide analogues; Prostagland E1; Reduced folates; Bile acids; Cholate; Cholyltaurine; Dehydroepiandrosterone sulfate
• TCDB ID: 3.A.1.208.7
• Gene ID: 10257
• KEGG Pathway:
  Antifolate resistance (hsa01523)
  ABC transporters (hsa02010)
  cAMP signaling pathway (hsa04024)
  Bile secretion (hsa04976)
• Reactome Pathway:
  ABC-family proteins mediated transport (R-HSA-382556)
  Azathioprine ADME (R-HSA-9748787)
  Paracetamol ADME (R-HSA-9753281)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DTP

29 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Abacavir	DMMN36E	Human immunodeficiency virus infection	1C62	Approved	[1]
Adefovir	DMM278X	Hepatitis B virus infection	1E51.0	Approved	[2]
Alprostadil	DMWH7NQ	Diabetic foot ulcer	BD54	Approved	[3]
Cefadroxil	DMMC345	Bacterial infection	1A00-1C4Z	Approved	[4]
Cefazolin	DMPDYFR	Bacterial infection	1A00-1C4Z	Approved	[4]
Ceftizoxime	DM3VOGS	Bacterial infection	1A00-1C4Z	Approved	[4]
Cholic acid	DM7OKQV	Peroxisomal disorder	5C57	Approved	[1]
Ciprofloxacin XR	DM2NLS9	Bacterial infection	1A00-1C4Z	Approved	[5]
Cladribine	DM3JDRP	Hairy cell leukaemia	2A82.2	Approved	[1]
Cyclophosphamide	DM4O2Z7	Solid tumour/cancer	2A00-2F9Z	Approved	[6]
Dehydroepiandrosterone sulfate	DM4Q80H	Dyspareunia	GA12	Approved	[7]
Dinoprostone	DMTYOPD	Medical abortion	JA00.1Z	Approved	[3]
Fluorouracil	DMUM7HZ	Solid tumour/cancer	2A00-2F9Z	Approved	[8]
Folic acid	DMEMBJC	Folate-deficiency anemia	3A02.Y	Approved	[9]
Ganciclovir	DM1MBYQ	Virus infection	1A24-1D9Z	Approved	[1]
Glutathione	DMAHMT9	Human immunodeficiency virus infection	1C62	Approved	[10]
Irinotecan	DMP6SC2	Colorectal cancer	2B91.Z	Approved	[11]
Leucovorin	DMUAZWG	Colorectal cancer	2B91.Z	Approved	[9]
Mercaptopurine	DMTM2IK	Acute lymphoblastic leukaemia	2A85	Approved	[12]
Methotrexate	DM2TEOL	leukaemia	2A60-2B33	Approved	[13]
Olmesartan medoxomil	DMWBHRY	High blood pressure	BA00	Approved	[14]
Oseltamivir	DMGO72P	Influenza virus infection	1E30-1E32	Approved	[15]
Prasterone	DM67VKL	Chronic obstructive pulmonary disease	CA22	Approved	[7]
Quercetin	DM3NC4M	Obesity	5B81	Approved	[1]
Sulindac	DM2QHZU	Rheumatoid arthritis	FA20	Approved	[16]
Tenofovir	DM1IS6U	Human immunodeficiency virus infection	1C62	Approved	[2]
Thioguanine	DM7NKEV	Acute myeloid leukaemia	2A60	Approved	[17]
Topotecan	DMP6G8T	Ovarian cancer	2C73	Approved	[18]
Zidovudine	DM4KI7O	Human immunodeficiency virus infection	1C62	Approved	[1]

6 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Camptothecin	DM6CHNJ	Solid tumour/cancer	2A00-2F9Z	Phase 3	[1]
Resveratrol	DM3RWXL	Giant cell arteritis	4A44.2	Phase 3	[1]
Rubitecan	DMDWU1S	Human immunodeficiency virus infection	1C62	Phase 3	[1]
LE-SN38	DMW50NF	Colorectal cancer	2B91.Z	Phase 2	[1]
Taurocholic acid	DM2LZ8F	Type-2 diabetes	5A11	Phase 1/2	[1]
PGF2alpha	DM4XAU7	Solid tumour/cancer	2A00-2F9Z	Clinical trial	[1]

1 Preclinical Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Azidothymidine monophosphate	DM3FLMR	Solid tumour/cancer	2A00-2F9Z	Preclinical	[19]

7 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
10-hydroxycamptothecin	DM9WLN4	Discovery agent	N.A.	Investigative	[1]
4-(2-Aminoethyl) benzenesulfonyl fluoride	DMWHDRI	Discovery agent	N.A.	Investigative	[16]
Aminohippuric acid	DMUN54G	Discovery agent	N.A.	Investigative	[20]
Glycocholic acid	DM0SXNM	Discovery agent	N.A.	Investigative	[1]
Glycodeoxycholic acid	DM1XEJV	Discovery agent	N.A.	Investigative	[1]
[3H]cAMP	DMZRQU7	Discovery agent	N.A.	Investigative	[21]
[3H]estradiol-17beta-glucuronide	DM3KJ45	Discovery agent	N.A.	Investigative	[22]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	4.44E-03	1.29E-01	2.96E-01
Adrenocortical carcinoma	2D11.Z	Kidney	3.28E-04	1.29E-01	1.01E+00
Alopecia	ED70	Skin from scalp	4.79E-03	5.95E-02	2.61E-01
Alzheimer's disease	8A20	Entorhinal cortex	3.73E-06	2.82E-01	7.01E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	1.89E-01	4.27E-01	8.89E-01
Aortic stenosis	BB70	Calcified aortic valve	8.92E-01	7.89E-02	1.65E-01
Apnea	7A40	Hyperplastic tonsil	4.64E-01	-1.07E-01	-7.84E-01
Arthropathy	FA00-FA5Z	Peripheral blood	1.30E-02	3.52E-01	8.22E-01
Asthma	CA23	Nasal and bronchial airway	6.01E-05	-4.10E-01	-3.86E-01
Atopic dermatitis	EA80	Skin	2.32E-03	7.78E-02	5.58E-01
Autism	6A02	Whole blood	6.20E-01	2.01E-02	3.88E-02
Autoimmune uveitis	9A96	Peripheral monocyte	2.92E-01	1.31E-01	5.28E-01
Autosomal dominant monocytopenia	4B04	Whole blood	1.24E-01	2.71E-01	1.14E+00
Bacterial infection of gingival	1C1H	Gingival tissue	3.99E-01	4.49E-02	1.30E-01
Batten disease	5C56.1	Whole blood	1.61E-01	-4.86E-01	-4.95E-01
Behcet's disease	4A62	Peripheral blood	9.32E-01	3.07E-03	6.77E-03
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	7.79E-01	-3.49E-04	-2.76E-03
Bladder cancer	2C94	Bladder tissue	3.77E-06	-3.12E+00	-5.55E+00
Breast cancer	2C60-2C6Z	Breast tissue	6.84E-05	8.79E-02	1.77E-01
Cardioembolic stroke	8B11.20	Whole blood	3.35E-01	1.12E-01	1.97E-01
Cervical cancer	2C77	Cervical tissue	8.85E-01	1.43E-02	6.54E-02
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	1.29E-02	4.24E-01	6.28E-01
Chronic hepatitis C	1E51.1	Whole blood	5.32E-01	-5.83E-02	-3.32E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	7.64E-01	-9.15E-02	-1.85E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.09E-09	-6.55E-01	-1.03E+00
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	3.17E-01	7.72E-02	4.63E-01
Colon cancer	2B90	Colon tissue	3.99E-04	-4.42E-01	-6.80E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	5.62E-01	-1.57E-01	-8.51E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	9.01E-01	5.23E-03	2.31E-02
Endometriosis	GA10	Endometrium tissue	3.78E-01	-2.23E-02	-1.90E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	1.45E-01	-1.84E-01	-7.08E-01
Familial hypercholesterolemia	5C80.00	Whole blood	1.52E-01	4.56E-01	8.84E-01
Gastric cancer	2B72	Gastric tissue	3.31E-03	7.37E-01	4.41E+00
Glioblastopma	2A00.00	Nervous tissue	1.17E-20	2.12E-01	5.35E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	9.78E-01	2.37E-01	2.99E-01
Head and neck cancer	2D42	Head and neck tissue	4.80E-02	-2.04E-02	-2.13E-02
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	4.29E-01	4.07E-03	1.82E-02
Huntington's disease	8A01.10	Whole blood	4.70E-01	1.37E-02	7.16E-02
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	2.79E-03	-9.72E-01	-2.65E+00
Immunodeficiency	4A00-4A20	Peripheral blood	3.25E-01	-4.22E-02	-4.98E-01
Influenza	1.00E+30	Whole blood	2.73E-03	-4.84E-01	-5.59E+00
Interstitial cystitis	GC00.3	Bladder tissue	2.74E-05	-1.55E+00	-4.39E+00
Intracranial aneurysm	8B01.0	Intracranial artery	2.08E-03	3.99E-01	2.58E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	8.50E-01	1.16E-02	2.81E-02
Ischemic stroke	8B11	Peripheral blood	6.25E-01	1.52E-01	3.54E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	7.09E-08	3.33E-01	8.17E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	6.31E-01	-1.10E-01	-5.41E-01
Lateral sclerosis	8B60.4	Skin	1.12E-01	3.55E-01	3.35E+00
Liver cancer	2C12.0	Liver tissue	4.53E-12	2.09E-01	9.71E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.38E-01	1.15E-01	9.05E-01
Lung cancer	2C25	Lung tissue	1.26E-03	-4.35E-01	-5.28E-01
Lupus erythematosus	4A40	Whole blood	1.43E-01	-9.45E-02	-1.52E-01
Major depressive disorder	6A70-6A7Z	Whole blood	3.15E-01	4.94E-02	1.00E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	9.08E-01	-3.28E-02	-2.63E-01
Melanoma	2C30	Skin	8.75E-02	5.66E-01	5.96E-01
Multiple myeloma	2A83.1	Bone marrow	4.65E-04	-4.21E-01	-2.33E+00
Multiple myeloma	2A83.1	Peripheral blood	6.72E-01	4.32E-02	1.84E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	9.96E-01	-7.25E-02	-1.82E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	7.81E-02	-2.29E-02	-7.70E-02
Myelofibrosis	2A20.2	Whole blood	7.42E-02	3.39E-01	2.35E+00
Myocardial infarction	BA41-BA50	Peripheral blood	5.30E-01	3.95E-01	3.47E-01
Myopathy	8C70.6	Muscle tissue	5.37E-01	4.57E-01	6.89E-01
Neonatal sepsis	KA60	Whole blood	6.38E-14	4.69E-01	1.32E+00
Neuroectodermal tumour	2A00.11	Brain stem tissue	1.37E-01	-3.31E-01	-4.74E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	4.19E-01	-9.76E-03	-8.17E-02
Obesity related type 2 diabetes	5A11	Omental adipose tissue	6.19E-01	3.46E-02	1.16E-01
Olive pollen allergy	CA08.00	Peripheral blood	1.18E-01	1.44E-01	9.57E-01
Oral cancer	2B6E	Oral tissue	1.63E-15	5.66E-01	2.56E+00
Osteoarthritis	FA00-FA0Z	Synovial tissue	2.49E-01	9.94E-02	2.94E-01
Osteoporosis	FB83.1	Bone marrow	7.16E-01	4.51E-01	2.51E+00
Ovarian cancer	2C73	Ovarian tissue	6.05E-04	8.98E-01	1.91E+00
Pancreatic cancer	2C10	Pancreas	1.26E-02	2.58E-01	6.82E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	3.22E-01	-9.85E-02	-3.01E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	1.12E-02	2.14E-01	8.20E-01
Pituitary cancer	2D12	Pituitary tissue	6.55E-04	2.70E-01	1.55E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	1.64E-03	3.45E-01	2.43E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	7.65E-02	-6.01E-02	-6.85E-01
Polycythemia vera	2A20.4	Whole blood	1.81E-05	8.86E-02	6.77E-01
Pompe disease	5C51.3	Biceps muscle	2.68E-02	3.34E-01	1.67E+00
Preterm birth	KA21.4Z	Myometrium	7.61E-02	-1.44E-01	-6.28E-01
Prostate cancer	2C82	Prostate	1.29E-05	1.99E+00	1.55E+00
Psoriasis	EA90	Skin	2.51E-01	-9.70E-02	-3.26E-01
Rectal cancer	2B92	Rectal colon tissue	7.19E-03	5.16E-01	1.81E+00
Renal cancer	2C90-2C91	Kidney	1.04E-01	5.13E-01	6.20E-01
Retinoblastoma	2D02.2	Uvea	1.77E-03	3.10E-01	3.29E+00
Rheumatoid arthritis	FA20	Synovial tissue	3.41E-10	6.77E-01	4.34E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	5.63E-01	-5.78E-02	-1.38E-01
Schizophrenia	6A20	Prefrontal cortex	9.83E-02	7.67E-02	1.61E-01
Schizophrenia	6A20	Superior temporal cortex	2.95E-01	2.68E-04	3.79E-03
Scleroderma	4A42.Z	Whole blood	3.18E-02	6.17E-01	1.24E+00
Seizure	8A60-8A6Z	Whole blood	4.53E-02	-1.94E-01	-4.09E-01
Sensitive skin	EK0Z	Skin	6.35E-01	1.09E-01	3.94E-01
Sepsis with septic shock	1G41	Whole blood	2.52E-05	1.35E-01	3.32E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	7.94E-03	5.06E-01	2.80E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	6.82E-02	1.01E+00	2.45E+00
Simpson golabi behmel syndrome	LD2C	Adipose tissue	4.24E-01	-8.94E-02	-9.54E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	5.98E-01	3.01E-03	4.22E-02
Skin cancer	2C30-2C3Z	Skin	3.82E-27	4.31E-01	1.23E+00
Thrombocythemia	3B63	Whole blood	2.28E-01	6.00E-02	4.49E-01
Thrombocytopenia	3B64	Whole blood	5.25E-01	-2.26E-01	-4.88E-01
Thyroid cancer	2D10	Thyroid	1.97E-09	-3.94E-01	-8.48E-01
Tibial muscular dystrophy	8C75	Muscle tissue	4.07E-01	2.22E-01	6.78E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	5.05E-02	2.16E-01	1.59E+00
Type 2 diabetes	5A11	Liver tissue	6.77E-01	3.03E-02	1.51E-01
Ureter cancer	2C92	Urothelium	6.37E-01	7.53E-03	8.24E-02
Uterine cancer	2C78	Endometrium tissue	4.35E-03	8.11E-02	2.44E-01
Vitiligo	ED63.0	Skin	1.45E-02	1.88E-01	7.27E-01

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Alprostadil	Approved	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 2.1 microM	[3]
Cefadroxil	Approved	Spodoptera frugiperda 21 (Sf21) cells-MRP4	Km = 0.25 microM	[4]
Cefazolin	Approved	Human embryonic kidney cells (HEK293)-MRP4	Km = 81 microM	[4]
Ceftizoxime	Approved	Human embryonic kidney cells (HEK293)-MRP4	Km = 18 microM	[4]
Dinoprostone	Approved	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 3.4 microM	[3]
Folic acid	Approved	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 170 microM	[9]
Methotrexate	Approved	Human embryonic kidney cells (HEK293)-MRP4	Km = 220 microM	[13]
Methotrexate	Approved	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 220 microM	[9]
Methotrexate	Approved	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 1300 microM	[23]
Olmesartan medoxomil	Approved	LLC-PK1 cells-MRP4	Km = 26.2 microM	[14]
Topotecan	Approved	Human liver cancer cells (HepG2)-MRP4	Km = 1.66 microM	[18]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Aminohippuric acid	Investigative	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 160 microM	[20]
[3H]cAMP	Investigative	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 44.5 microM	[24]
[3H]estradiol-17beta-glucuronide	Investigative	Spodoptera frugiperda (Sf9) cells-MRP4	Km = 30.3 microM	[24]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Multidrug resistance protein 4 (ABCC4) DTT Info
• DTP DTT Type: Literature-reported

References

• [1] Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
• [2] Functional involvement of multidrug resistance-associated protein 4 (MRP4/ABCC4) in the renal elimination of the antiviral drugs adefovir and tenofovir. Mol Pharmacol. 2007 Feb;71(2):619-27.
• [3] The human multidrug resistance protein MRP4 functions as a prostaglandin efflux transporter and is inhibited by nonsteroidal antiinflammatory drugs. Proc Natl Acad Sci U S A. 2003 Aug 5;100(16):9244-9.
• [4] Oral availability of cefadroxil depends on ABCC3 and ABCC4. Drug Metab Dispos. 2012 Mar;40(3):515-21.
• [5] Identification of the efflux transporter of the fluoroquinolone antibiotic ciprofloxacin in murine macrophages: studies with ciprofloxacin-resistant cells. Antimicrob Agents Chemother. 2009 Jun;53(6):2410-6.
• [6] Interaction of oxazaphosphorines with multidrug resistance-associated protein 4 (MRP4). AAPS J. 2010 Sep;12(3):300-8.
• [7] Steroid and bile acid conjugates are substrates of human multidrug-resistance protein (MRP) 4 (ATP-binding cassette C4). Biochem J. 2003 Apr 15;371(Pt 2):361-7.
• [8] ATP-binding cassette C transporters in human pancreatic carcinoma cell lines. Upregulation in 5-fluorouracil-resistant cells. Pancreatology. 2009;9(1-2):136-44.
• [9] Analysis of methotrexate and folate transport by multidrug resistance protein 4 (ABCC4): MRP4 is a component of the methotrexate efflux system. Cancer Res. 2002 Jun 1;62(11):3144-50.
• [10] Role of glutathione in the multidrug resistance protein 4 (MRP4/ABCC4)-mediated efflux of cAMP and resistance to purine analogues. Biochem J. 2002 Feb 1;361(Pt 3):497-503.
• [11] P-glycoprotein, but not multidrug resistance protein 4, plays a role in the systemic clearance of irinotecan and SN-38 in mice. Drug Metab Lett. 2010 Dec;4(4):195-201.
• [12] Polymorphisms in multidrug resistance-associated protein gene 4 is associated with outcome in childhood acute lymphoblastic leukemia. Blood. 2009 Aug 13;114(7):1383-6.
• [13] Interaction of nonsteroidal anti-inflammatory drugs with multidrug resistance protein (MRP) 2/ABCC2- and MRP4/ABCC4-mediated methotrexate transport. J Pharmacol Exp Ther. 2007 Jan;320(1):229-35.
• [14] Multiple human isoforms of drug transporters contribute to the hepatic and renal transport of olmesartan, a selective antagonist of the angiotensin II AT1-receptor. Drug Metab Dispos. 2007 Dec;35(12):2166-76.
• [15] Limited brain distribution of [3R,4R,5S]-4-acetamido-5-amino-3-(1-ethylpropoxy)-1-cyclohexene-1-carboxylate phosphate (Ro 64-0802), a pharmacologically active form of oseltamivir, by active efflux across the blood-brain barrier mediated by organic anion transporter 3 (Oat3/Slc22a8) and multidrug resistance-associated protein 4 (Mrp4/Abcc4). Drug Metab Dispos. 2009 Feb;37(2):315-21.
• [16] Fluo-cAMP is transported by multidrug resistance-associated protein isoform 4 in rat choroid plexus. J Neurochem. 2010 Oct;115(1):200-8.
• [17] Multidrug resistance protein 4 (MRP4/ABCC4) mediates efflux of bimane-glutathione. Int J Biochem Cell Biol. 2004 Feb;36(2):247-57.
• [18] Topotecan is a substrate for multidrug resistance associated protein 4. Curr Drug Metab. 2006 Jan;7(1):105-18.
• [19] MRP4: A previously unidentified factor in resistance to nucleoside-based antiviral drugs. Nat Med. 1999 Sep;5(9):1048-51.
• [20] Contribution of multidrug resistance protein 2 (MRP2/ABCC2) to the renal excretion of p-aminohippurate (PAH) and identification of MRP4 (ABCC4) as a novel PAH transporter. J Am Soc Nephrol. 2004 Nov;15(11):2828-35.
• [21] cAMP regulates expression of the cyclic nucleotide transporter MRP4 (ABCC4) through the EPAC pathway. Pharmacogenet Genomics. 2014 Oct;24(10):522-6.
• [22] Multidrug resistance-associated proteins 3, 4, and 5. Pflugers Arch. 2007 Feb;453(5):661-73.
• [23] The MRP4/ABCC4 gene encodes a novel apical organic anion transporter in human kidney proximal tubules: putative efflux pump for urinary cAMP and cGMP. J Am Soc Nephrol. 2002 Mar;13(3):595-603.
• [24] Transport of cyclic nucleotides and estradiol 17-beta-D-glucuronide by multidrug resistance protein 4. Resistance to 6-mercaptopurine and 6-thioguanine. J Biol Chem. 2001 Sep 7;276(36):33747-54.