Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTCSGPB)

DTP Name Multidrug resistance-associated protein 4 (ABCC4)
Gene Name ABCC4
UniProt ID
O15439 (MRP4_HUMAN)
VARIDT ID
DTD0015
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABCC4; ATP-binding cassette sub-family C member 4; MOAT-B; MOATB; MRP/cMOAT-related ABC transporter; MRP4; Multi-specific organic anion transporter B
DTP Family ATP-Binding Cassette (ABC) Superfamily
Drug Conjugate Transporter (DCT) Family (ABCC)
Tissue Specificity Widely expressed, with particularly highlevels in prostate, but is barely detectable in liver.
Sequence
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEEL
QGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYF
ENYDPMDSVALNTAYAYATVLTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALR
LSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAG
MAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGA
VRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQ
QPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQK
ARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVW
SQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILL
NTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVATVLFGI
ARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFV
IIVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLE
KEAPWEYQKRPPPAWPHEGVIIFDNVNFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAG
KSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNE
HTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTI
FETAL
Function This transporter may be an organic anion pump relevant to cellular detoxification.
Endogenous Substrate(s) 9-(2-phosphonylmethyoxyethyl)adenine; Cyclic nucleotides; Estradiol 17-beta-D-glucuronides; Leukotrienes; Nucleotide analogues; Prostagland E1; Reduced folates; Bile acids; Cholate; Cholyltaurine; Dehydroepiandrosterone sulfate
TCDB ID
3.A.1.208.7
Gene ID
10257
KEGG Pathway
Antifolate resistance (hsa01523 )
ABC transporters (hsa02010 )
cAMP signaling pathway (hsa04024 )
Bile secretion (hsa04976 )
Reactome Pathway
ABC-family proteins mediated transport (R-HSA-382556 )
Azathioprine ADME (R-HSA-9748787 )
Paracetamol ADME (R-HSA-9753281 )
Platelet degranulation (R-HSA-114608 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
29 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Abacavir DMMN36E Human immunodeficiency virus infection 1C62 Approved [1]
Adefovir DMM278X N. A. N. A. Approved [2]
Alprostadil DMWH7NQ Aorta coarctation Approved [3]
Cefadroxil DMMC345 Bacterial infection 1A00-1C4Z Approved [4]
Cefazolin DMPDYFR Bacteremia 1A73 Approved [4]
Ceftizoxime DM3VOGS Acute gonococcal cervicitis Approved [4]
Cholic Acid DM7OKQV Cholelithiasis DC11 Approved [1]
Ciprofloxacin XR DM2NLS9 Acute gonococcal cervicitis Approved [5]
Cladribine DM3JDRP Hairy cell leukaemia 2A82.2 Approved [1]
Cyclophosphamide DM4O2Z7 Advanced cancer 2A00-2F9Z Approved [6]
Dehydroepiandrosterone sulfate DM4Q80H N. A. N. A. Approved [7]
Dinoprostone DMTYOPD Medical abortion JA00.1Z Approved [3]
Fluorouracil DMUM7HZ Adenocarcinoma 2D40 Approved [8]
Folic Acid DMEMBJC Colorectal carcinoma Approved [9]
Ganciclovir DM1MBYQ Cytomegalovirus infection 1D82 Approved [1]
Glutathione DMAHMT9 Human immunodeficiency virus infection 1C62 Approved [10]
Irinotecan DMP6SC2 Adenocarcinoma 2D40 Approved [11]
Leucovorin DMUAZWG Colon adenocarcinoma Approved [9]
Mercaptopurine DMTM2IK Acute lymphoblastic leukaemia 2A85 Approved [12]
Methotrexate DM2TEOL Anterior urethra cancer Approved [13]
Olmesartan medoxomil DMWBHRY High blood pressure BA00 Approved [14]
Oseltamivir DMGO72P Influenza 1E30-1E32 Approved [15]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [7]
Quercetin DM3NC4M Obesity 5B81 Approved [1]
Sulindac DM2QHZU Acute myelogenous leukaemia 2A41 Approved [16]
Tenofovir DM1IS6U Chronic hepatitis B virus infection Approved [2]
Thioguanine DM7NKEV Acute lymphocytic leukaemia 2B33.3 Approved [17]
Topotecan DMP6G8T Central nervous system neoplasm Approved [18]
Zidovudine DM4KI7O Human immunodeficiency virus infection 1C62 Approved [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 29 Approved Drug(s)
6 Clinical Trial Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Camptothecin DM6CHNJ Solid tumour/cancer 2A00-2F9Z Phase 3 [1]
Resveratrol DM3RWXL Giant cell arteritis 4A44.2 Phase 3 [1]
Rubitecan DMDWU1S Human immunodeficiency virus infection 1C62 Phase 3 [1]
LE-SN38 DMW50NF Colorectal cancer 2B91.Z Phase 2 [1]
Taurocholic Acid DM2LZ8F Type-2 diabetes 5A11 Phase 1/2 [1]
PGF2alpha DM4XAU7 Solid tumour/cancer 2A00-2F9Z Clinical trial [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Clinical Trial Drug(s)
1 Preclinical Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Azidothymidine monophosphate DM3FLMR N. A. N. A. Preclinical [19]
------------------------------------------------------------------------------------
7 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
10-hydroxycamptothecin DM9WLN4 Discovery agent N.A. Investigative [1]
4-(2-Aminoethyl) benzenesulfonyl fluoride DMWHDRI N. A. N. A. Investigative [16]
AMINOHIPPURIC ACID DMUN54G Discovery agent N.A. Investigative [20]
glycocholic acid DM0SXNM Discovery agent N.A. Investigative [1]
glycodeoxycholic acid DM1XEJV Discovery agent N.A. Investigative [1]
[3H]cAMP DMZRQU7 Discovery agent N.A. Investigative [21]
[3H]estradiol-17beta-glucuronide DM3KJ45 Discovery agent N.A. Investigative [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.44E-03 1.29E-01 2.96E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.28E-04 1.29E-01 1.01E+00
Alopecia ED70 Skin from scalp 4.79E-03 5.95E-02 2.61E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.73E-06 2.82E-01 7.01E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.89E-01 4.27E-01 8.89E-01
Aortic stenosis BB70 Calcified aortic valve 8.92E-01 7.89E-02 1.65E-01
Apnea 7A40 Hyperplastic tonsil 4.64E-01 -1.07E-01 -7.84E-01
Arthropathy FA00-FA5Z Peripheral blood 1.30E-02 3.52E-01 8.22E-01
Asthma CA23 Nasal and bronchial airway 6.01E-05 -4.10E-01 -3.86E-01
Atopic dermatitis EA80 Skin 2.32E-03 7.78E-02 5.58E-01
Autism 6A02 Whole blood 6.20E-01 2.01E-02 3.88E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.92E-01 1.31E-01 5.28E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.24E-01 2.71E-01 1.14E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.99E-01 4.49E-02 1.30E-01
Batten disease 5C56.1 Whole blood 1.61E-01 -4.86E-01 -4.95E-01
Behcet's disease 4A62 Peripheral blood 9.32E-01 3.07E-03 6.77E-03
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.79E-01 -3.49E-04 -2.76E-03
Bladder cancer 2C94 Bladder tissue 3.77E-06 -3.12E+00 -5.55E+00
Breast cancer 2C60-2C6Z Breast tissue 6.84E-05 8.79E-02 1.77E-01
Cardioembolic stroke 8B11.20 Whole blood 3.35E-01 1.12E-01 1.97E-01
Cervical cancer 2C77 Cervical tissue 8.85E-01 1.43E-02 6.54E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.29E-02 4.24E-01 6.28E-01
Chronic hepatitis C 1E51.1 Whole blood 5.32E-01 -5.83E-02 -3.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.64E-01 -9.15E-02 -1.85E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.09E-09 -6.55E-01 -1.03E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.17E-01 7.72E-02 4.63E-01
Colon cancer 2B90 Colon tissue 3.99E-04 -4.42E-01 -6.80E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.62E-01 -1.57E-01 -8.51E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.01E-01 5.23E-03 2.31E-02
Endometriosis GA10 Endometrium tissue 3.78E-01 -2.23E-02 -1.90E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.45E-01 -1.84E-01 -7.08E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.52E-01 4.56E-01 8.84E-01
Gastric cancer 2B72 Gastric tissue 3.31E-03 7.37E-01 4.41E+00
Glioblastopma 2A00.00 Nervous tissue 1.17E-20 2.12E-01 5.35E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.78E-01 2.37E-01 2.99E-01
Head and neck cancer 2D42 Head and neck tissue 4.80E-02 -2.04E-02 -2.13E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.29E-01 4.07E-03 1.82E-02
Huntington's disease 8A01.10 Whole blood 4.70E-01 1.37E-02 7.16E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.79E-03 -9.72E-01 -2.65E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.25E-01 -4.22E-02 -4.98E-01
Influenza 1.00E+30 Whole blood 2.73E-03 -4.84E-01 -5.59E+00
Interstitial cystitis GC00.3 Bladder tissue 2.74E-05 -1.55E+00 -4.39E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.08E-03 3.99E-01 2.58E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.50E-01 1.16E-02 2.81E-02
Ischemic stroke 8B11 Peripheral blood 6.25E-01 1.52E-01 3.54E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.09E-08 3.33E-01 8.17E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.31E-01 -1.10E-01 -5.41E-01
Lateral sclerosis 8B60.4 Skin 1.12E-01 3.55E-01 3.35E+00
Liver cancer 2C12.0 Liver tissue 4.53E-12 2.09E-01 9.71E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.38E-01 1.15E-01 9.05E-01
Lung cancer 2C25 Lung tissue 1.26E-03 -4.35E-01 -5.28E-01
Lupus erythematosus 4A40 Whole blood 1.43E-01 -9.45E-02 -1.52E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.15E-01 4.94E-02 1.00E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.08E-01 -3.28E-02 -2.63E-01
Melanoma 2C30 Skin 8.75E-02 5.66E-01 5.96E-01
Multiple myeloma 2A83.1 Bone marrow 4.65E-04 -4.21E-01 -2.33E+00
Multiple myeloma 2A83.1 Peripheral blood 6.72E-01 4.32E-02 1.84E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.96E-01 -7.25E-02 -1.82E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.81E-02 -2.29E-02 -7.70E-02
Myelofibrosis 2A20.2 Whole blood 7.42E-02 3.39E-01 2.35E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.30E-01 3.95E-01 3.47E-01
Myopathy 8C70.6 Muscle tissue 5.37E-01 4.57E-01 6.89E-01
Neonatal sepsis KA60 Whole blood 6.38E-14 4.69E-01 1.32E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.37E-01 -3.31E-01 -4.74E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.19E-01 -9.76E-03 -8.17E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.19E-01 3.46E-02 1.16E-01
Olive pollen allergy CA08.00 Peripheral blood 1.18E-01 1.44E-01 9.57E-01
Oral cancer 2B6E Oral tissue 1.63E-15 5.66E-01 2.56E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.49E-01 9.94E-02 2.94E-01
Osteoporosis FB83.1 Bone marrow 7.16E-01 4.51E-01 2.51E+00
Ovarian cancer 2C73 Ovarian tissue 6.05E-04 8.98E-01 1.91E+00
Pancreatic cancer 2C10 Pancreas 1.26E-02 2.58E-01 6.82E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.22E-01 -9.85E-02 -3.01E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.12E-02 2.14E-01 8.20E-01
Pituitary cancer 2D12 Pituitary tissue 6.55E-04 2.70E-01 1.55E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.64E-03 3.45E-01 2.43E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.65E-02 -6.01E-02 -6.85E-01
Polycythemia vera 2A20.4 Whole blood 1.81E-05 8.86E-02 6.77E-01
Pompe disease 5C51.3 Biceps muscle 2.68E-02 3.34E-01 1.67E+00
Preterm birth KA21.4Z Myometrium 7.61E-02 -1.44E-01 -6.28E-01
Prostate cancer 2C82 Prostate 1.29E-05 1.99E+00 1.55E+00
Psoriasis EA90 Skin 2.51E-01 -9.70E-02 -3.26E-01
Rectal cancer 2B92 Rectal colon tissue 7.19E-03 5.16E-01 1.81E+00
Renal cancer 2C90-2C91 Kidney 1.04E-01 5.13E-01 6.20E-01
Retinoblastoma 2D02.2 Uvea 1.77E-03 3.10E-01 3.29E+00
Rheumatoid arthritis FA20 Synovial tissue 3.41E-10 6.77E-01 4.34E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.63E-01 -5.78E-02 -1.38E-01
Schizophrenia 6A20 Prefrontal cortex 9.83E-02 7.67E-02 1.61E-01
Schizophrenia 6A20 Superior temporal cortex 2.95E-01 2.68E-04 3.79E-03
Scleroderma 4A42.Z Whole blood 3.18E-02 6.17E-01 1.24E+00
Seizure 8A60-8A6Z Whole blood 4.53E-02 -1.94E-01 -4.09E-01
Sensitive skin EK0Z Skin 6.35E-01 1.09E-01 3.94E-01
Sepsis with septic shock 1G41 Whole blood 2.52E-05 1.35E-01 3.32E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.94E-03 5.06E-01 2.80E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.82E-02 1.01E+00 2.45E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.24E-01 -8.94E-02 -9.54E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.98E-01 3.01E-03 4.22E-02
Skin cancer 2C30-2C3Z Skin 3.82E-27 4.31E-01 1.23E+00
Thrombocythemia 3B63 Whole blood 2.28E-01 6.00E-02 4.49E-01
Thrombocytopenia 3B64 Whole blood 5.25E-01 -2.26E-01 -4.88E-01
Thyroid cancer 2D10 Thyroid 1.97E-09 -3.94E-01 -8.48E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.07E-01 2.22E-01 6.78E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.05E-02 2.16E-01 1.59E+00
Type 2 diabetes 5A11 Liver tissue 6.77E-01 3.03E-02 1.51E-01
Ureter cancer 2C92 Urothelium 6.37E-01 7.53E-03 8.24E-02
Uterine cancer 2C78 Endometrium tissue 4.35E-03 8.11E-02 2.44E-01
Vitiligo ED63.0 Skin 1.45E-02 1.88E-01 7.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)
Drug Name Highest Status Cell Line Affinity REF
Alprostadil Approved Spodoptera frugiperda (Sf9) cells-MRP4 Km = 2.1 microM [3]
Cefadroxil Approved Spodoptera frugiperda 21 (Sf21) cells-MRP4 Km = 0.25 microM [4]
Cefazolin Approved Human embryonic kidney cells (HEK293)-MRP4 Km = 81.0 microM [4]
Ceftizoxime Approved Human embryonic kidney cells (HEK293)-MRP4 Km = 18.0 microM [4]
Dinoprostone Approved Spodoptera frugiperda (Sf9) cells-MRP4 Km = 3.4 microM [3]
Folic Acid Approved Spodoptera frugiperda (Sf9) cells-MRP4 Km = 170.0 microM [9]
Methotrexate Approved Human embryonic kidney cells (HEK293)-MRP4 Km = 220.0 microM [13]
Methotrexate Approved Spodoptera frugiperda (Sf9) cells-MRP4 Km = 220.0 microM [9]
Methotrexate Approved Spodoptera frugiperda (Sf9) cells-MRP4 Km = 1300.0 microM [23]
Olmesartan medoxomil Approved LLC-PK1 cells-MRP4 Km = 26.2 microM [14]
Topotecan Approved Human liver cancer cells (HepG2)-MRP4 Km = 1.66 microM [18]
⏷ Show the Full List of 11 Approved Drug(s)
Investigative Drug(s)
Drug Name Highest Status Cell Line Affinity REF
AMINOHIPPURIC ACID Investigative Spodoptera frugiperda (Sf9) cells-MRP4 Km = 160.0 microM [20]
[3H]cAMP Investigative Spodoptera frugiperda (Sf9) cells-MRP4 Km = 44.5 microM [24]
[3H]estradiol-17beta-glucuronide Investigative Spodoptera frugiperda (Sf9) cells-MRP4 Km = 30.3 microM [24]

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Multidrug resistance protein 4 (ABCC4) DTT Info
DTP DTT Type Literature-reported

References

1 Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
2 Functional involvement of multidrug resistance-associated protein 4 (MRP4/ABCC4) in the renal elimination of the antiviral drugs adefovir and tenofovir. Mol Pharmacol. 2007 Feb;71(2):619-27.
3 The human multidrug resistance protein MRP4 functions as a prostaglandin efflux transporter and is inhibited by nonsteroidal antiinflammatory drugs. Proc Natl Acad Sci U S A. 2003 Aug 5;100(16):9244-9.
4 Oral availability of cefadroxil depends on ABCC3 and ABCC4. Drug Metab Dispos. 2012 Mar;40(3):515-21.
5 Identification of the efflux transporter of the fluoroquinolone antibiotic ciprofloxacin in murine macrophages: studies with ciprofloxacin-resistant cells. Antimicrob Agents Chemother. 2009 Jun;53(6):2410-6.
6 Interaction of oxazaphosphorines with multidrug resistance-associated protein 4 (MRP4). AAPS J. 2010 Sep;12(3):300-8.
7 Steroid and bile acid conjugates are substrates of human multidrug-resistance protein (MRP) 4 (ATP-binding cassette C4). Biochem J. 2003 Apr 15;371(Pt 2):361-7.
8 ATP-binding cassette C transporters in human pancreatic carcinoma cell lines. Upregulation in 5-fluorouracil-resistant cells. Pancreatology. 2009;9(1-2):136-44.
9 Analysis of methotrexate and folate transport by multidrug resistance protein 4 (ABCC4): MRP4 is a component of the methotrexate efflux system. Cancer Res. 2002 Jun 1;62(11):3144-50.
10 Role of glutathione in the multidrug resistance protein 4 (MRP4/ABCC4)-mediated efflux of cAMP and resistance to purine analogues. Biochem J. 2002 Feb 1;361(Pt 3):497-503.
11 P-glycoprotein, but not multidrug resistance protein 4, plays a role in the systemic clearance of irinotecan and SN-38 in mice. Drug Metab Lett. 2010 Dec;4(4):195-201.
12 Polymorphisms in multidrug resistance-associated protein gene 4 is associated with outcome in childhood acute lymphoblastic leukemia. Blood. 2009 Aug 13;114(7):1383-6.
13 Interaction of nonsteroidal anti-inflammatory drugs with multidrug resistance protein (MRP) 2/ABCC2- and MRP4/ABCC4-mediated methotrexate transport. J Pharmacol Exp Ther. 2007 Jan;320(1):229-35.
14 Multiple human isoforms of drug transporters contribute to the hepatic and renal transport of olmesartan, a selective antagonist of the angiotensin II AT1-receptor. Drug Metab Dispos. 2007 Dec;35(12):2166-76.
15 Limited brain distribution of [3R,4R,5S]-4-acetamido-5-amino-3-(1-ethylpropoxy)-1-cyclohexene-1-carboxylate phosphate (Ro 64-0802), a pharmacologically active form of oseltamivir, by active efflux across the blood-brain barrier mediated by organic anion transporter 3 (Oat3/Slc22a8) and multidrug resistance-associated protein 4 (Mrp4/Abcc4). Drug Metab Dispos. 2009 Feb;37(2):315-21.
16 Fluo-cAMP is transported by multidrug resistance-associated protein isoform 4 in rat choroid plexus. J Neurochem. 2010 Oct;115(1):200-8.
17 Multidrug resistance protein 4 (MRP4/ABCC4) mediates efflux of bimane-glutathione. Int J Biochem Cell Biol. 2004 Feb;36(2):247-57.
18 Topotecan is a substrate for multidrug resistance associated protein 4. Curr Drug Metab. 2006 Jan;7(1):105-18.
19 MRP4: A previously unidentified factor in resistance to nucleoside-based antiviral drugs. Nat Med. 1999 Sep;5(9):1048-51.
20 Contribution of multidrug resistance protein 2 (MRP2/ABCC2) to the renal excretion of p-aminohippurate (PAH) and identification of MRP4 (ABCC4) as a novel PAH transporter. J Am Soc Nephrol. 2004 Nov;15(11):2828-35.
21 cAMP regulates expression of the cyclic nucleotide transporter MRP4 (ABCC4) through the EPAC pathway. Pharmacogenet Genomics. 2014 Oct;24(10):522-6.
22 Multidrug resistance-associated proteins 3, 4, and 5. Pflugers Arch. 2007 Feb;453(5):661-73.
23 The MRP4/ABCC4 gene encodes a novel apical organic anion transporter in human kidney proximal tubules: putative efflux pump for urinary cAMP and cGMP. J Am Soc Nephrol. 2002 Mar;13(3):595-603.
24 Transport of cyclic nucleotides and estradiol 17-beta-D-glucuronide by multidrug resistance protein 4. Resistance to 6-mercaptopurine and 6-thioguanine. J Biol Chem. 2001 Sep 7;276(36):33747-54.