Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTSYQGK)

DTP Name Multidrug resistance-associated protein 1 (ABCC1)
Gene Name ABCC1
UniProt ID
P33527 (MRP1_HUMAN)
VARIDT ID
DTD0001
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABC29; ABCC; ABCC1; ATP-binding cassette sub-family C member 1; GS-X; LTC4 transporter; Leukotriene C(4) transporter; MRP; MRP1
DTP Family ATP-Binding Cassette (ABC) Superfamily
Drug Conjugate Transporter (DCT) Family (ABCC)
Tissue Specificity High expressed in testis, cardiomyocytes, placenta, prostate, lung, thymus, and kidney, lower expression in small intestine, colon, brain, and mononuclear cells
Sequence
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSD
LWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
ALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLF
SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
Function
This transporter mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
Endogenous Substrate(s) Antimonial oxyanions; Antimony; Arsenic oxyanions; Arsenic triglutathione; Glutathione conjugates; Mercuric ions; Arsenate; Glucuronide-X; Aflatoxin B1-glutathione; Cobalamine; Leukotriene C4
TCDB ID
3.A.1.208.8
Gene ID
4363
KEGG Pathway
Antifolate resistance (hsa01523 )
ABC transporters (hsa02010 )
Sphingolipid signaling pathway (hsa04071 )
Vitamin digestion and absorption (hsa04977 )
MicroRNAs in cancer (hsa05206 )
Reactome Pathway
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
ABC-family proteins mediated transport (R-HSA-382556 )
Cytoprotection by HMOX1 (R-HSA-9707564 )
Paracetamol ADME (R-HSA-9753281 )
Transport of RCbl within the body (R-HSA-9758890 )
Heme degradation (R-HSA-189483 )
BioCyc Pathway
MetaCyc:ENSG00000103222-MON

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
38 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
99mTc-sestamibi DMVZO01 Breast cancer 2C60-2C65 Approved [1]
Adefovir DMM278X N. A. N. A. Approved [2]
Cefadroxil DMMC345 Bacterial infection 1A00-1C4Z Approved [3]
Chlorpheniramine DM5URA2 Allergic rhinitis CA08.0 Approved [4]
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [5]
Citalopram DM2G9AE Acute coronary syndrome BA41 Approved [6]
Colchicine DM2POTE Acute gout flare FA25.0 Approved [7]
Dactinomycin DM2YGNW Adult kidney Wilms tumor Approved [8]
Daunorubicin DMQUSBT Acute monocytic leukemia Approved [9]
Dehydroepiandrosterone sulfate DM4Q80H N. A. N. A. Approved [10]
Docetaxel DMDI269 Advanced cancer 2A00-2F9Z Approved [2]
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [11]
Epirubicin DMPDW6T Solid tumour/cancer 2A00-2F9Z Approved [12]
Estrone sulfate DMVBIZL Atrophic vaginitis GA30.2 Approved [13]
Ethacrynic acid DM60QMR Edema MG29 Approved [14]
Etoposide DMNH3PG Acute myelogenous leukaemia 2A41 Approved [15]
FLUORESCEIN DMQTFAO Ocular disease 1F00.1Z Approved [16]
Flutamide DMK0O7U Prostate cancer 2C82.0 Approved [17]
Folic Acid DMEMBJC Colorectal carcinoma Approved [18]
Glutathione DMAHMT9 Human immunodeficiency virus infection 1C62 Approved [19]
Grepafloxacin DMGLX0T Chronic bronchitis CA20.1 Approved [20]
Idarubicin DMM0XGL Acute myelogenous leukaemia 2A41 Approved [2]
Indinavir DM0T3YH Human immunodeficiency virus infection 1C62 Approved [2]
Irinotecan DMP6SC2 Adenocarcinoma 2D40 Approved [21]
Ivermectin DMDBX5F Intestinal strongyloidiasis due to nematode parasite 1F6B Approved [22]
Lopinavir DMITQS0 Human immunodeficiency virus infection 1C62 Approved [23]
Methotrexate DM2TEOL Anterior urethra cancer Approved [24]
Mitoxantrone DMM39BF Acute myelogenous leukaemia 2A41 Approved [25]
Paclitaxel DMLB81S Breast carcinoma Approved [2]
Phenytoin DMNOKBV Epilepsy 8A60-8A68 Approved [26]
Quercetin DM3NC4M Obesity 5B81 Approved [2]
Saquinavir DMG814N Human immunodeficiency virus infection 1C62 Approved [27]
Saxagliptin DMGXENV Type-2 diabetes 5A11 Approved [28]
Topotecan DMP6G8T Central nervous system neoplasm Approved [2]
Verapamil DMA7PEW Angina pectoris BA40 Approved [2]
Vinblastine DM5TVS3 Advanced cancer 2A00-2F9Z Approved [29]
Vincristine DMINOX3 Acute lymphoblastic leukaemia 2A85 Approved [30]
Zoledronate DMIXC7G Adenocarcinoma 2D40 Approved [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 38 Approved Drug(s)
5 Clinical Trial Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Resveratrol DM3RWXL Giant cell arteritis 4A44.2 Phase 3 [2]
Glutathione-S-S-glutathione DMJ85FS N. A. N. A. Phase 2 [32]
LE-SN38 DMW50NF Colorectal cancer 2B91.Z Phase 2 [21]
PEITC DMOMN31 Prostate cancer 2C82.0 Phase 2 [2]
Chlorcyclizine DM3L52Q Allergic rhinitis CA08.0 Phase 1 [4]
------------------------------------------------------------------------------------
5 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
AMINOHIPPURIC ACID DMUN54G Discovery agent N.A. Investigative [33]
Arsenite DMBCO4Q Discovery agent N.A. Investigative [34]
Fluo-3 DMLO9FU N. A. N. A. Investigative [35]
LTE4 DMCPB0Q Discovery agent N.A. Investigative [36]
[3H]estradiol-17beta-glucuronide DM3KJ45 Discovery agent N.A. Investigative [37]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.56E-36 6.27E-01 1.80E+00
Adrenocortical carcinoma 2D11.Z Kidney 2.93E-06 5.19E-01 1.66E+00
Alopecia ED70 Skin from scalp 3.46E-04 -1.40E-01 -8.32E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.12E-01 -1.61E-02 -7.68E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.98E-02 1.33E-01 7.11E-01
Aortic stenosis BB70 Calcified aortic valve 1.40E-01 -1.41E-01 -5.82E-01
Apnea 7A40 Hyperplastic tonsil 2.85E-01 -4.25E-01 -8.86E-01
Arthropathy FA00-FA5Z Peripheral blood 8.27E-01 1.42E-02 7.14E-02
Asthma CA23 Nasal and bronchial airway 1.34E-04 3.10E-01 6.28E-01
Atopic dermatitis EA80 Skin 1.04E-06 3.87E-01 1.96E+00
Autism 6A02 Whole blood 5.97E-02 1.65E-01 5.91E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.81E-01 2.77E-01 1.13E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.76E-01 -2.28E-01 -3.64E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.85E-03 -7.73E-02 -2.51E-01
Batten disease 5C56.1 Whole blood 1.51E-01 2.62E-01 1.16E+00
Behcet's disease 4A62 Peripheral blood 2.72E-01 -1.08E-01 -6.06E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.91E-01 5.05E-02 3.65E-01
Bladder cancer 2C94 Bladder tissue 6.46E-01 1.04E-01 4.49E-01
Breast cancer 2C60-2C6Z Breast tissue 1.33E-51 5.67E-01 1.25E+00
Cardioembolic stroke 8B11.20 Whole blood 3.20E-08 -2.35E-01 -1.52E+00
Cervical cancer 2C77 Cervical tissue 3.12E-01 -1.62E-01 -4.67E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.74E-01 -2.94E-02 -6.77E-02
Chronic hepatitis C 1E51.1 Whole blood 1.94E-01 -1.57E-01 -6.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.29E-01 -9.91E-02 -3.13E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.36E-01 9.99E-02 1.76E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.46E-01 8.06E-02 3.25E-01
Colon cancer 2B90 Colon tissue 7.37E-83 1.18E+00 2.79E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.94E-02 8.17E-01 2.37E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.05E-01 -3.36E-01 -6.36E-01
Endometriosis GA10 Endometrium tissue 1.14E-01 -1.75E-01 -2.98E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.96E-02 1.97E-01 1.36E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.19E-14 7.14E-01 1.96E+00
Gastric cancer 2B72 Gastric tissue 4.46E-01 1.71E-02 2.50E-01
Glioblastopma 2A00.00 Nervous tissue 2.59E-117 5.51E-01 1.85E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.63E-06 1.04E+00 2.01E+00
Head and neck cancer 2D42 Head and neck tissue 1.78E-08 3.79E-01 7.37E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.64E-01 -6.82E-02 -4.02E-01
Huntington's disease 8A01.10 Whole blood 1.05E-01 2.66E-01 1.26E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.86E-01 -1.55E-02 -1.02E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.96E-01 7.49E-02 4.20E-01
Influenza 1.00E+30 Whole blood 9.95E-03 -1.09E+00 -4.47E+00
Interstitial cystitis GC00.3 Bladder tissue 6.37E-04 4.06E-01 2.74E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.56E-04 5.40E-01 1.66E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.81E-05 1.69E-01 7.86E-01
Ischemic stroke 8B11 Peripheral blood 1.86E-01 7.59E-02 5.27E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.54E-02 2.81E-02 1.09E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.96E-01 -3.74E-02 -1.61E-01
Lateral sclerosis 8B60.4 Skin 4.28E-01 3.21E-02 7.04E-01
Liver cancer 2C12.0 Liver tissue 5.12E-23 4.83E-01 2.27E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.26E-07 1.23E+00 4.48E+00
Lung cancer 2C25 Lung tissue 1.90E-30 1.76E-01 7.31E-01
Lupus erythematosus 4A40 Whole blood 6.18E-01 -1.23E-01 -1.77E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.97E-01 2.69E-02 1.29E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.25E-01 2.18E-02 1.51E-01
Melanoma 2C30 Skin 9.59E-01 -1.61E-03 -1.85E-03
Multiple myeloma 2A83.1 Bone marrow 2.70E-03 -2.31E-01 -1.64E+00
Multiple myeloma 2A83.1 Peripheral blood 6.19E-01 9.35E-02 4.62E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.80E-01 1.96E-01 9.51E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.47E-01 1.60E-01 4.95E-01
Myelofibrosis 2A20.2 Whole blood 3.79E-03 -2.19E-01 -1.94E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.48E-01 3.49E-02 3.16E-02
Myopathy 8C70.6 Muscle tissue 9.68E-01 -1.58E-01 -3.24E-01
Neonatal sepsis KA60 Whole blood 1.66E-01 -2.21E-02 -7.13E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.68E-08 5.65E-01 3.11E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.11E-01 1.06E-01 6.93E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.77E-01 -2.35E-01 -4.78E-01
Olive pollen allergy CA08.00 Peripheral blood 4.49E-03 -5.38E-01 -2.58E+00
Oral cancer 2B6E Oral tissue 7.17E-05 5.93E-01 7.85E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.27E-01 3.65E-01 2.65E-01
Osteoporosis FB83.1 Bone marrow 4.50E-01 2.98E-01 1.00E+00
Ovarian cancer 2C73 Ovarian tissue 1.01E-02 8.86E-01 1.34E+00
Pancreatic cancer 2C10 Pancreas 1.59E-02 4.29E-01 6.42E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.67E-01 -1.78E-01 -9.02E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.43E-01 -4.51E-02 -2.08E-01
Pituitary cancer 2D12 Pituitary tissue 1.32E-01 1.31E-01 3.58E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.73E-01 8.94E-02 2.11E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.70E-01 4.44E-03 1.55E-02
Polycythemia vera 2A20.4 Whole blood 8.62E-18 -2.79E-01 -2.34E+00
Pompe disease 5C51.3 Biceps muscle 1.30E-02 -5.80E-01 -1.75E+00
Preterm birth KA21.4Z Myometrium 2.70E-01 -8.13E-03 -2.91E-02
Prostate cancer 2C82 Prostate 8.18E-07 9.06E-01 1.81E+00
Psoriasis EA90 Skin 5.41E-31 8.62E-01 2.11E+00
Rectal cancer 2B92 Rectal colon tissue 1.09E-07 1.67E+00 7.60E+00
Renal cancer 2C90-2C91 Kidney 8.37E-06 6.90E-01 2.31E+00
Retinoblastoma 2D02.2 Uvea 1.88E-05 4.71E-01 3.14E+00
Rheumatoid arthritis FA20 Synovial tissue 3.15E-06 7.81E-01 3.00E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.23E-01 -4.28E-02 -2.17E-01
Schizophrenia 6A20 Prefrontal cortex 1.98E-01 -1.14E-02 -1.24E-02
Schizophrenia 6A20 Superior temporal cortex 4.62E-01 -5.08E-02 -4.17E-01
Scleroderma 4A42.Z Whole blood 1.05E-02 2.28E-01 1.68E+00
Seizure 8A60-8A6Z Whole blood 8.01E-01 6.69E-02 2.82E-01
Sensitive skin EK0Z Skin 2.56E-02 1.97E-01 1.71E+00
Sepsis with septic shock 1G41 Whole blood 2.81E-21 -2.79E-01 -9.75E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.98E-03 -6.52E-01 -3.66E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.31E-02 6.70E-01 1.77E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.61E-01 5.25E-01 8.84E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.09E-01 1.08E-01 6.07E-01
Skin cancer 2C30-2C3Z Skin 4.74E-11 4.66E-01 7.32E-01
Thrombocythemia 3B63 Whole blood 2.67E-06 -2.44E-01 -2.29E+00
Thrombocytopenia 3B64 Whole blood 8.19E-01 -5.75E-02 -2.33E-01
Thyroid cancer 2D10 Thyroid 1.13E-06 -2.97E-01 -8.71E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.51E-01 -3.44E-01 -4.04E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.55E-01 -4.95E-02 -4.48E-01
Type 2 diabetes 5A11 Liver tissue 3.82E-01 1.16E-01 9.50E-01
Ureter cancer 2C92 Urothelium 5.78E-02 -1.38E-01 -7.56E-01
Uterine cancer 2C78 Endometrium tissue 3.85E-01 2.71E-02 6.12E-02
Vitiligo ED63.0 Skin 5.68E-01 -1.35E-01 -1.03E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)
Drug Name Highest Status Cell Line Affinity REF
Cefadroxil Approved Human embryonic kidney cells (HEK293)-MRP1 Km = 3.9 microM [3]
Citalopram Approved Human embryonic kidney cells (HEK293)-MRP1 Km = 1.99 microM [6]
Daunorubicin Approved Human small cell lung cancer cells Km = 1.4 microM [38]
Epirubicin Approved Human cervical cancer cell line (Hela)-MRP1 Km = 0.097 microM [12]
Glutathione Approved Human cervical cancer cell line (Hela)-MRP1 Km = 5000.0 microM [39]
Methotrexate Approved Breast carcinoma cell line (MCF7)-MRP1 Km = 930.0 microM [40]
Methotrexate Approved Human embryonic kidney cells (HEK293)-MRP1 Km = 2150.0 microM [24]
Methotrexate Approved NIH3T3-MRP1 Km = 2150.0 microM [24]
⏷ Show the Full List of 8 Approved Drug(s)
Investigative Drug(s)
Drug Name Highest Status Cell Line Affinity REF
AMINOHIPPURIC ACID Investigative Human cervical cancer cell line (Hela)-MRP1 Km = 372.0 microM [33]
[3H]estradiol-17beta-glucuronide Investigative Human cervical cancer cell line (Hela)-MRP1 Km = 1.5 microM [36]
[3H]estradiol-17beta-glucuronide Investigative Human cervical cancer cell line (Hela)-MRP1 Km = 2.5 microM [41]
[3H]estradiol-17beta-glucuronide Investigative Human embryonic kidney cells (HEK293)-MRP1 Km = 1.5 microM [37]

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name HUMAN multidrug resistance-associated protein 1 (ABCC1) DTT Info

References

1 99mTc-sestamibi is a substrate for P-glycoprotein and the multidrug resistance-associated protein. Br J Cancer. 1998;77(3):353-8.
2 Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
3 Oral availability of cefadroxil depends on ABCC3 and ABCC4. Drug Metab Dispos. 2012 Mar;40(3):515-21.
4 Carrier mediated transport of chlorpheniramine and chlorcyclizine across bovine olfactory mucosa: implications on nose-to-brain transport. J Pharm Sci. 2005 Mar;94(3):613-24.
5 Hammerhead ribozyme against gamma-glutamylcysteine synthetase sensitizes human colonic cancer cells to cisplatin by down-regulating both the glutathione synthesis and the expression of multidrug resistance proteins. Cancer Gene Ther. 2001 Oct;8(10):803-14.
6 MRP1 polymorphisms associated with citalopram response in patients with major depression. J Clin Psychopharmacol. 2010 Apr;30(2):116-25.
7 Pharmacological characterization of the murine and human orthologs of multidrug-resistance protein in transfected human embryonic kidney cells. Mol Pharmacol. 1997 Sep;52(3):344-53.
8 Expression of multidrug resistance-associated protein in NIH/3T3 cells confers multidrug resistance associated with increased drug efflux and altered intracellular drug distribution. Cancer Res. 1995 Nov 15;55(22):5342-7.
9 Vinblastine and sulfinpyrazone export by the multidrug resistance protein MRP2 is associated with glutathione export. Br J Cancer. 2000 Aug;83(3):375-83.
10 Steroid and bile acid conjugates are substrates of human multidrug-resistance protein (MRP) 4 (ATP-binding cassette C4). Biochem J. 2003 Apr 15;371(Pt 2):361-7.
11 The role of bioreductive activation of doxorubicin in cytotoxic activity against leukaemia HL60-sensitive cell line and its multidrug-resistant sublines. Br J Cancer. 2005 Jul 11;93(1):89-97.
12 Sulindac sulfide selectively increases sensitivity of ABCC1 expressing tumor cells to doxorubicin and glutathione depletion. J Biomed Res. 2016 Mar;30(2):120-133.
13 Molecular cloning and pharmacological characterization of rat multidrug resistance protein 1 (mrp1). Drug Metab Dispos. 2003 Aug;31(8):1016-26.
14 Inhibition of the multidrug resistance protein 1 (MRP1) by peptidomimetic glutathione-conjugate analogs. Mol Pharmacol. 2002 Nov;62(5):1160-6.
15 Multidrug resistance-associated protein-1 functional activity in Calu-3 cells. J Pharmacol Exp Ther. 2001 Sep;298(3):1199-205.
16 Transport of fluorescein in MDCKII-MRP1 transfected cells and mrp1-knockout mice. Biochem Biophys Res Commun. 2001 Jun 22;284(4):863-9.
17 The multidrug resistance-associated protein 1 transports methoxychlor and protects the seminiferous epithelium from injury. Toxicol Lett. 2003 Apr 30;142(1-2):61-70.
18 Folate concentration dependent transport activity of the Multidrug Resistance Protein 1 (ABCC1). Biochem Pharmacol. 2004 Apr 15;67(8):1541-8.
19 Structural determinants of substrate specificity differences between human multidrug resistance protein (MRP) 1 (ABCC1) and MRP3 (ABCC3). Drug Metab Dispos. 2008 Dec;36(12):2571-81.
20 Limited distribution of new quinolone antibacterial agents into brain caused by multiple efflux transporters at the blood-brain barrier. J Pharmacol Exp Ther. 2000 Oct;295(1):146-52.
21 ATP-Dependent efflux of CPT-11 and SN-38 by the multidrug resistance protein (MRP) and its inhibition by PAK-104P. Mol Pharmacol. 1999 May;55(5):921-8.
22 Interaction of ivermectin with multidrug resistance proteins (MRP1, 2 and 3). Chem Biol Interact. 2006 Feb 25;159(3):169-79.
23 Inhibition of P-glycoprotein and multidrug resistance-associated proteins modulates the intracellular concentration of lopinavir in cultured CD4 T cells and primary human lymphocytes. J Antimicrob Chemother. 2007 Nov;60(5):987-93.
24 Transport of methotrexate (MTX) and folates by multidrug resistance protein (MRP) 3 and MRP1: effect of polyglutamylation on MTX transport. Cancer Res. 2001 Oct 1;61(19):7225-32.
25 Multidrug resistance protein 1 (MRP1, ABCC1) mediates resistance to mitoxantrone via glutathione-dependent drug efflux. Mol Pharmacol. 2006 Apr;69(4):1499-505.
26 Evaluation of transport of common antiepileptic drugs by human multidrug resistance-associated proteins (MRP1, 2 and 5) that are overexpressed in pharmacoresistant epilepsy. Neuropharmacology. 2010 Jun;58(7):1019-32.
27 Direct evidence that saquinavir is transported by multidrug resistance-associated protein (MRP1) and canalicular multispecific organic anion transporter (MRP2). Antimicrob Agents Chemother. 2002 Nov;46(11):3456-62.
28 Dipeptidylpeptidase-4 inhibitors (gliptins): focus on drug-drug interactions. Clin Pharmacokinet. 2010 Sep;49(9):573-88.
29 Development and characterization of a recombinant Madin-Darby canine kidney cell line that expresses rat multidrug resistance-associated protein 1 (rMRP1). AAPS PharmSci. 2004 Mar 9;6(1):E8.
30 Interaction of plant cannabinoids with the multidrug transporter ABCC1 (MRP1). Eur J Pharmacol. 2008 Sep 4;591(1-3):128-31.
31 Zoledronic acid is synergic with vinblastine to induce apoptosis in a multidrug resistance protein-1 dependent way: an in vitro study. Cell Biol Int. 2006 Mar;30(3):278-82.
32 Anthracyclines modulate multidrug resistance protein (MRP) mediated organic anion transport. Biochim Biophys Acta. 1997 May 22;1326(1):12-22.
33 ATP-dependent para-aminohippurate transport by apical multidrug resistance protein MRP2. Kidney Int. 2000 Apr;57(4):1636-42.
34 Comparative Molecular Docking Studies with ABCC1 and Aquaporin 9 in the Arsenite Complex Efflux. Bioinformation. 2014 Aug 30;10(8):474-9.
35 Export pumps for anionic conjugates encoded by MRP genes. Adv Enzyme Regul. 1999;39:237-46.
36 Transport of glutathione, glucuronate, and sulfate conjugates by the MRP gene-encoded conjugate export pump. Cancer Res. 1996 Mar 1;56(5):988-94.
37 Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells. Mol Pharmacol. 1999 May;55(5):929-37.
38 Competitive inhibition by genistein and ATP dependence of daunorubicin transport in intact MRP overexpressing human small cell lung cancer cells. Biochem Pharmacol. 1994 Sep 15;48(6):1129-36.
39 Topological polar surface area defines substrate transport by multidrug resistance associated protein 1 (MRP1/ABCC1). J Med Chem. 2009 Feb 26;52(4):1214-8.
40 Multidrug resistance protein (MRP) 1 and MRP3 attenuate cytotoxic and transactivating effects of the cyclopentenone prostaglandin, 15-deoxy-Delta(12,14)prostaglandin J2 in MCF7 breast cancer cells. Biochemistry. 2003 May 13;42(18):5429-37.
41 ATP-dependent 17 beta-estradiol 17-(beta-D-glucuronide) transport by multidrug resistance protein (MRP). Inhibition by cholestatic steroids. J Biol Chem. 1996 Apr 19;271(16):9683-9.