Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5BZ1J9)

DOT Name	Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1)
Synonyms	PI3-kinase regulatory subunit alpha; PI3K regulatory subunit alpha; PtdIns-3-kinase regulatory subunit alpha; Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha; PI3-kinase subunit p85-alpha; PtdIns-3-kinase regulatory subunit p85-alpha
Gene Name	PIK3R1
Related Disease	Agammaglobulinemia 7, autosomal recessive ( ) Immunodeficiency 36 ( ) Prostate cancer ( ) SHORT syndrome ( ) Adult glioblastoma ( ) Agammaglobulinemia ( ) Alcohol dependence ( ) Bladder cancer ( ) Brain neoplasm ( ) Breast cancer ( ) Breast carcinoma ( ) Breast neoplasm ( ) Bronchiectasis ( ) Bruton-type agammaglobulinemia ( ) Colon cancer ( ) Colorectal carcinoma ( ) Colorectal neoplasm ( ) Cutaneous melanoma ( ) Endometrial cancer ( ) Endometrial carcinoma ( ) Exanthem ( ) Glioma ( ) Hepatocellular carcinoma ( ) Hyperglycemia ( ) Immunodeficiency 14 ( ) Lipodystrophy ( ) Lung cancer ( ) Lung carcinoma ( ) Ovarian cancer ( ) Prostate carcinoma ( ) Prostate neoplasm ( ) Rieger anomaly ( ) Type-1/2 diabetes ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Vitiligo ( ) Burkitt lymphoma ( ) Immunodeficiency ( ) Non-insulin dependent diabetes ( ) Activated PI3K-delta syndrome ( ) Autosomal agammaglobulinemia ( ) High blood pressure ( ) Undifferentiated carcinoma ( ) Carcinoma ( ) Clear cell renal carcinoma ( ) Colon carcinoma ( ) Non-small-cell lung cancer ( ) Obesity ( )
UniProt ID	P85A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1A0N ; 1AZG ; 1H9O ; 1PBW ; 1PHT ; 1PIC ; 1PKS ; 1PKT ; 2IUG ; 2IUH ; 2IUI ; 2RD0 ; 2V1Y ; 3HHM ; 3HIZ ; 3I5R ; 3I5S ; 4A55 ; 4JPS ; 4L1B ; 4L23 ; 4L2Y ; 4OVU ; 4OVV ; 4WAF ; 4YKN ; 4ZOP ; 5AUL ; 5FI4 ; 5GJI ; 5ITD ; 5M6U ; 5SW8 ; 5SWG ; 5SWO ; 5SWP ; 5SWR ; 5SWT ; 5SX8 ; 5SX9 ; 5SXA ; 5SXB ; 5SXC ; 5SXD ; 5SXE ; 5SXF ; 5SXI ; 5SXJ ; 5SXK ; 5UBT ; 5UK8 ; 5UKJ ; 5UL1 ; 5VLR ; 5XGH ; 5XGI ; 5XGJ ; 6NCT ; 6PYR ; 6PYU ; 7CIO ; 7LM2 ; 7LQ1 ; 7MYN ; 7MYO ; 7PG5 ; 7PG6 ; 7RNS ; 7TZ7 ; 8DCP ; 8DCX ; 8DD4 ; 8DD8 ; 8GUB ; 8H36 ; 8H37 ; 8ILR ; 8ILS ; 8ILV ; 8SBC ; 8SBJ ; 8TDU ; 8TGD ; 8TS7 ; 8TS8 ; 8TS9 ; 8TSA ; 8TSB ; 8TSC ; 8TSD ; 8TU6
Pfam ID	PF16454 ; PF00620 ; PF00017
Sequence	MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR
Function	Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues. Plays an important role in signaling in response to FGFR1, FGFR2, FGFR3, FGFR4, KITLG/SCF, KIT, PDGFRA and PDGFRB. Likewise, plays a role in ITGB2 signaling. Modulates the cellular response to ER stress by promoting nuclear translocation of XBP1 isoform 2 in a ER stress- and/or insulin-dependent manner during metabolic overloading in the liver and hence plays a role in glucose tolerance improvement.
Tissue Specificity	Isoform 2 is expressed in skeletal muscle and brain, and at lower levels in kidney and cardiac muscle. Isoform 2 and isoform 4 are present in skeletal muscle (at protein level).
KEGG Pathway	EGFR tyrosine ki.se inhibitor resistance (hsa01521 ) Endocrine resistance (hsa01522 ) Platinum drug resistance (hsa01524 ) ErbB sig.ling pathway (hsa04012 ) Ras sig.ling pathway (hsa04014 ) Rap1 sig.ling pathway (hsa04015 ) cAMP sig.ling pathway (hsa04024 ) Chemokine sig.ling pathway (hsa04062 ) HIF-1 sig.ling pathway (hsa04066 ) FoxO sig.ling pathway (hsa04068 ) Phosphatidylinositol sig.ling system (hsa04070 ) Sphingolipid sig.ling pathway (hsa04071 ) Phospholipase D sig.ling pathway (hsa04072 ) Autophagy - animal (hsa04140 ) mTOR sig.ling pathway (hsa04150 ) PI3K-Akt sig.ling pathway (hsa04151 ) AMPK sig.ling pathway (hsa04152 ) Apoptosis (hsa04210 ) Longevity regulating pathway (hsa04211 ) Longevity regulating pathway - multiple species (hsa04213 ) Cellular senescence (hsa04218 ) Axon guidance (hsa04360 ) VEGF sig.ling pathway (hsa04370 ) Osteoclast differentiation (hsa04380 ) Focal adhesion (hsa04510 ) Sig.ling pathways regulating pluripotency of stem cells (hsa04550 ) Platelet activation (hsa04611 ) Neutrophil extracellular trap formation (hsa04613 ) Toll-like receptor sig.ling pathway (hsa04620 ) C-type lectin receptor sig.ling pathway (hsa04625 ) JAK-STAT sig.ling pathway (hsa04630 ) .tural killer cell mediated cytotoxicity (hsa04650 ) T cell receptor sig.ling pathway (hsa04660 ) B cell receptor sig.ling pathway (hsa04662 ) Fc epsilon RI sig.ling pathway (hsa04664 ) Fc gamma R-mediated phagocytosis (hsa04666 ) TNF sig.ling pathway (hsa04668 ) Leukocyte transendothelial migration (hsa04670 ) Neurotrophin sig.ling pathway (hsa04722 ) Cholinergic sy.pse (hsa04725 ) Inflammatory mediator regulation of TRP channels (hsa04750 ) Regulation of actin cytoskeleton (hsa04810 ) Insulin sig.ling pathway (hsa04910 ) Progesterone-mediated oocyte maturation (hsa04914 ) Estrogen sig.ling pathway (hsa04915 ) Prolactin sig.ling pathway (hsa04917 ) Thyroid hormone sig.ling pathway (hsa04919 ) Regulation of lipolysis in adipocytes (hsa04923 ) Relaxin sig.ling pathway (hsa04926 ) GnRH secretion (hsa04929 ) Type II diabetes mellitus (hsa04930 ) Insulin resistance (hsa04931 ) Non-alcoholic fatty liver disease (hsa04932 ) AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 ) Growth hormone synthesis, secretion and action (hsa04935 ) Aldosterone-regulated sodium reabsorption (hsa04960 ) Carbohydrate digestion and absorption (hsa04973 ) Alzheimer disease (hsa05010 ) Spinocerebellar ataxia (hsa05017 ) Prion disease (hsa05020 ) Bacterial invasion of epithelial cells (hsa05100 ) Shigellosis (hsa05131 ) Yersinia infection (hsa05135 ) Chagas disease (hsa05142 ) Amoebiasis (hsa05146 ) Hepatitis C (hsa05160 ) Hepatitis B (hsa05161 ) Measles (hsa05162 ) Human cytomegalovirus infection (hsa05163 ) Influenza A (hsa05164 ) Human papillomavirus infection (hsa05165 ) Human T-cell leukemia virus 1 infection (hsa05166 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Herpes simplex virus 1 infection (hsa05168 ) Epstein-Barr virus infection (hsa05169 ) Human immunodeficiency virus 1 infection (hsa05170 ) Coro.virus disease - COVID-19 (hsa05171 ) Pathways in cancer (hsa05200 ) Viral carcinogenesis (hsa05203 ) Proteoglycans in cancer (hsa05205 ) MicroR.s in cancer (hsa05206 ) Chemical carcinogenesis - receptor activation (hsa05207 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) Colorectal cancer (hsa05210 ) Re.l cell carcinoma (hsa05211 ) Pancreatic cancer (hsa05212 ) Endometrial cancer (hsa05213 ) Glioma (hsa05214 ) Prostate cancer (hsa05215 ) Melanoma (hsa05218 ) Chronic myeloid leukemia (hsa05220 ) Acute myeloid leukemia (hsa05221 ) Small cell lung cancer (hsa05222 ) Non-small cell lung cancer (hsa05223 ) Breast cancer (hsa05224 ) Hepatocellular carcinoma (hsa05225 ) Gastric cancer (hsa05226 ) Central carbon metabolism in cancer (hsa05230 ) Choline metabolism in cancer (hsa05231 ) PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 ) Diabetic cardiomyopathy (hsa05415 ) Lipid and atherosclerosis (hsa05417 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	IRS-mediated signalling (R-HSA-112399 ) GPVI-mediated activation cascade (R-HSA-114604 ) Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants (R-HSA-1236382 ) PI3K events in ERBB4 signaling (R-HSA-1250342 ) PIP3 activates AKT signaling (R-HSA-1257604 ) Interleukin-7 signaling (R-HSA-1266695 ) Signaling by SCF-KIT (R-HSA-1433557 ) Synthesis of PIPs at the plasma membrane (R-HSA-1660499 ) GAB1 signalosome (R-HSA-180292 ) Signaling by cytosolic FGFR1 fusion mutants (R-HSA-1839117 ) Downstream signal transduction (R-HSA-186763 ) PI3K events in ERBB2 signaling (R-HSA-1963642 ) PI3K/AKT activation (R-HSA-198203 ) Signaling by ALK (R-HSA-201556 ) Downstream TCR signaling (R-HSA-202424 ) Role of phospholipids in phagocytosis (R-HSA-2029485 ) Tie2 Signaling (R-HSA-210993 ) Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 ) DAP12 signaling (R-HSA-2424491 ) Role of LAT2/NTAL/LAB on calcium mobilization (R-HSA-2730905 ) Nephrin family interactions (R-HSA-373753 ) Costimulation by the CD28 family (R-HSA-388841 ) CD28 dependent PI3K/Akt signaling (R-HSA-389357 ) G alpha (q) signalling events (R-HSA-416476 ) GP1b-IX-V activation signalling (R-HSA-430116 ) VEGFA-VEGFR2 Pathway (R-HSA-4420097 ) Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988 ) Constitutive Signaling by EGFRvIII (R-HSA-5637810 ) PI-3K cascade (R-HSA-5654689 ) PI-3K cascade (R-HSA-5654695 ) PI-3K cascade (R-HSA-5654710 ) PI-3K cascade (R-HSA-5654720 ) Signaling by FGFR2 in disease (R-HSA-5655253 ) Signaling by FGFR4 in disease (R-HSA-5655291 ) Signaling by FGFR1 in disease (R-HSA-5655302 ) Signaling by FGFR3 in disease (R-HSA-5655332 ) RAF/MAP kinase cascade (R-HSA-5673001 ) Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 ) PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 ) MET activates PI3K/AKT signaling (R-HSA-8851907 ) RET signaling (R-HSA-8853659 ) RHOA GTPase cycle (R-HSA-8980692 ) Extra-nuclear estrogen signaling (R-HSA-9009391 ) RHOB GTPase cycle (R-HSA-9013026 ) RHOC GTPase cycle (R-HSA-9013106 ) CDC42 GTPase cycle (R-HSA-9013148 ) RAC1 GTPase cycle (R-HSA-9013149 ) RAC2 GTPase cycle (R-HSA-9013404 ) RHOD GTPase cycle (R-HSA-9013405 ) RHOG GTPase cycle (R-HSA-9013408 ) RHOJ GTPase cycle (R-HSA-9013409 ) RHOU GTPase cycle (R-HSA-9013420 ) RAC3 GTPase cycle (R-HSA-9013423 ) RHOV GTPase cycle (R-HSA-9013424 ) Erythropoietin activates Phosphoinositide-3-kinase (PI3K) (R-HSA-9027276 ) Activated NTRK2 signals through PI3K (R-HSA-9028335 ) RHOF GTPase cycle (R-HSA-9035034 ) Interleukin receptor SHC signaling (R-HSA-912526 ) Regulation of signaling by CBL (R-HSA-912631 ) Activated NTRK3 signals through PI3K (R-HSA-9603381 ) FLT3 Signaling (R-HSA-9607240 ) Signaling by ERBB2 KD Mutants (R-HSA-9664565 ) Signaling by ERBB2 ECD mutants (R-HSA-9665348 ) Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants (R-HSA-9670439 ) Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants (R-HSA-9673767 ) Signaling by PDGFRA extracellular domain mutants (R-HSA-9673770 ) Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350 ) RND3 GTPase cycle (R-HSA-9696264 ) RND2 GTPase cycle (R-HSA-9696270 ) RND1 GTPase cycle (R-HSA-9696273 ) Signaling by FLT3 fusion proteins (R-HSA-9703465 ) Signaling by FLT3 ITD and TKD mutants (R-HSA-9703648 ) Signaling by ALK fusions and activated point mutants (R-HSA-9725370 ) Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695 ) PI3K Cascade (R-HSA-109704 )
BioCyc Pathway	MetaCyc:ENSG00000145675-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Agammaglobulinemia 7, autosomal recessive	DISWT394	Definitive	Autosomal recessive	[1]
Immunodeficiency 36	DISFGFCW	Definitive	Autosomal dominant	[2]
Prostate cancer	DISF190Y	Definitive	Altered Expression	[3]
SHORT syndrome	DIS4TAKA	Definitive	Autosomal dominant	[4]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[5]
Agammaglobulinemia	DISXMS80	Strong	Biomarker	[6]
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[7]
Bladder cancer	DISUHNM0	Strong	Biomarker	[8]
Brain neoplasm	DISY3EKS	Strong	Genetic Variation	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[10]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[10]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[11]
Bronchiectasis	DIS5MYEE	Strong	Biomarker	[12]
Bruton-type agammaglobulinemia	DISQ5ZYP	Strong	Genetic Variation	[13]
Colon cancer	DISVC52G	Strong	Biomarker	[14]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[15]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[9]
Cutaneous melanoma	DIS3MMH9	Strong	Genetic Variation	[9]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[16]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[16]
Exanthem	DISAFOQN	Strong	Genetic Variation	[17]
Glioma	DIS5RPEH	Strong	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[19]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[20]
Immunodeficiency 14	DISI1EMU	Strong	Genetic Variation	[21]
Lipodystrophy	DIS3SGVD	Strong	Biomarker	[22]
Lung cancer	DISCM4YA	Strong	Biomarker	[23]
Lung carcinoma	DISTR26C	Strong	Biomarker	[23]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[24]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[3]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[25]
Rieger anomaly	DISNBLZ5	Strong	Biomarker	[26]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[27]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[8]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[8]
Vitiligo	DISR05SL	Strong	Biomarker	[28]
Burkitt lymphoma	DIS9D5XU	moderate	Biomarker	[29]
Immunodeficiency	DIS093I0	moderate	Genetic Variation	[13]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Genetic Variation	[30]
Activated PI3K-delta syndrome	DISRL9M9	Supportive	Autosomal dominant	[31]
Autosomal agammaglobulinemia	DISRW8BT	Supportive	Autosomal dominant	[1]
High blood pressure	DISY2OHH	Disputed	Biomarker	[32]
Undifferentiated carcinoma	DISIAZST	Disputed	Biomarker	[33]
Carcinoma	DISH9F1N	Limited	Biomarker	[34]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[35]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[14]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[36]
Obesity	DIS47Y1K	Limited	Biomarker	[37]
------------------------------------------------------------------------------------


⏷ Show the Full List of 48 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1) decreases the response to substance of Cisplatin.	[83]
Daunorubicin	DMQUSBT	Approved	Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1) affects the response to substance of Daunorubicin.	[84]
------------------------------------------------------------------------------------

42 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[38]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[43]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[44]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[45]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[46]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[48]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[49]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[50]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[51]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[52]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[53]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[54]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[49]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[56]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[57]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[58]
Imatinib	DM7RJXL	Approved	Imatinib decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[59]
Nefazodone	DM4ZS8M	Approved	Nefazodone decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[60]
Atazanavir	DMSYRBX	Approved	Atazanavir decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[60]
Cantharidin	DMBP5N3	Approved	Cantharidin decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[61]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[62]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[63]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[64]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[65]
Contigoside B	DMX9V8K	Phase 2/3	Contigoside B increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[67]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[68]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[70]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[71]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[72]
Celastrol	DMWQIJX	Preclinical	Celastrol decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[73]
Wortmannin	DM8EVK5	Terminated	Wortmannin decreases the activity of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[74]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[38]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[77]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[78]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN affects the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[79]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[80]
U0126	DM31OGF	Investigative	U0126 increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[71]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[81]
------------------------------------------------------------------------------------


⏷ Show the Full List of 42 Drug(s)

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the phosphorylation of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[47]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the phosphorylation of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[55]
Coprexa	DMA0WEK	Phase 3	Coprexa decreases the phosphorylation of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[66]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[69]
ABT-100	DMPFLS5	Terminated	ABT-100 decreases the phosphorylation of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[75]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[76]
3h-Indole-5,6-Diol	DMBFCTZ	Investigative	3h-Indole-5,6-Diol increases the phosphorylation of Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1).	[82]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Agammaglobulinemia and absent B lineage cells in a patient lacking the p85 subunit of PI3K. J Exp Med. 2012 Mar 12;209(3):463-70. doi: 10.1084/jem.20112533. Epub 2012 Feb 20.
2	Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
3	LSD1 Activates PI3K/AKT Signaling Through Regulating p85 Expression in Prostate Cancer Cells.Front Oncol. 2019 Aug 2;9:721. doi: 10.3389/fonc.2019.00721. eCollection 2019.
4	PIK3R1 mutations cause syndromic insulin resistance with lipoatrophy. Am J Hum Genet. 2013 Jul 11;93(1):141-9. doi: 10.1016/j.ajhg.2013.05.019. Epub 2013 Jun 27.
5	Yes and PI3K bind CD95 to signal invasion of glioblastoma.Cancer Cell. 2008 Mar;13(3):235-48. doi: 10.1016/j.ccr.2008.02.003.
6	Heterozygous splice mutation in PIK3R1 causes human immunodeficiency with lymphoproliferation due to dominant activation of PI3K.J Exp Med. 2014 Dec 15;211(13):2537-47. doi: 10.1084/jem.20141759. Epub 2014 Dec 8.
7	Can we identify genes for alcohol consumption in samples ascertained for heterogeneous purposes?.Alcohol Clin Exp Res. 2009 Apr;33(4):729-39. doi: 10.1111/j.1530-0277.2008.00890.x. Epub 2009 Jan 22.
8	p85 Inactivates MMP-2 and Suppresses Bladder Cancer Invasion by Inhibiting MMP-14 Transcription and TIMP-2 Degradation.Neoplasia. 2019 Sep;21(9):908-920. doi: 10.1016/j.neo.2019.07.007. Epub 2019 Aug 8.
9	Identifying recurrent mutations in cancer reveals widespread lineage diversity and mutational specificity.Nat Biotechnol. 2016 Feb;34(2):155-63. doi: 10.1038/nbt.3391. Epub 2015 Nov 30.
10	Significant prognostic values of differentially expressed-aberrantly methylated hub genes in breast cancer.J Cancer. 2019 Oct 21;10(26):6618-6634. doi: 10.7150/jca.33433. eCollection 2019.
11	microRNA-155 positively regulates glucose metabolism via PIK3R1-FOXO3a-cMYC axis in breast cancer.Oncogene. 2018 May;37(22):2982-2991. doi: 10.1038/s41388-018-0124-4. Epub 2018 Mar 12.
12	Respiratory Manifestations of the Activated Phosphoinositide 3-Kinase Delta Syndrome.Front Immunol. 2018 Mar 5;9:338. doi: 10.3389/fimmu.2018.00338. eCollection 2018.
13	Too much of a good thing: immunodeficiency due to hyperactive PI3K signaling.J Clin Invest. 2014 Sep;124(9):3688-90. doi: 10.1172/JCI77198. Epub 2014 Aug 18.
14	Inhibition of Growth and Metastasis of Colon Cancer by Delivering 5-Fluorouracil-loaded Pluronic P85 Copolymer Micelles.Sci Rep. 2016 Feb 11;6:20896. doi: 10.1038/srep20896.
15	DC-SIGN-LEF1/TCF1-miR-185 feedback loop promotes colorectal cancer invasion and metastasis.Cell Death Differ. 2020 Jan;27(1):379-395. doi: 10.1038/s41418-019-0361-2. Epub 2019 Jun 19.
16	A First-in-Human Phase 1 Study of LY3023414, an Oral PI3K/mTOR Dual Inhibitor, in Patients with Advanced Cancer.Clin Cancer Res. 2018 Jul 15;24(14):3253-3262. doi: 10.1158/1078-0432.CCR-17-3421. Epub 2018 Apr 10.
17	High-throughput screening identified inherited genetic variations in the EGFR pathway contributing to skin toxicity of EGFR inhibitors.Pharmacogenomics. 2015;16(14):1605-19. doi: 10.2217/pgs.15.97. Epub 2015 Sep 30.
18	Next-generation whole exome sequencing of glioblastoma with a primitive neuronal component.Brain Tumor Pathol. 2019 Jul;36(3):129-134. doi: 10.1007/s10014-019-00334-1. Epub 2019 Feb 4.
19	5-Hydroxytryptamine Receptor 1D Aggravates Hepatocellular Carcinoma Progression Through FoxO6 in AKT-Dependent and Independent Manners.Hepatology. 2019 May;69(5):2031-2047. doi: 10.1002/hep.30430. Epub 2019 Mar 10.
20	Ginsenoside Rb1 increases insulin sensitivity through suppressing 11-hydroxysteroid dehydrogenase type I.Am J Transl Res. 2017 Mar 15;9(3):1049-1057. eCollection 2017.
21	Conformational disruption of PI3K regulation by immunodeficiency mutations in PIK3CD and PIK3R1.Proc Natl Acad Sci U S A. 2017 Feb 21;114(8):1982-1987. doi: 10.1073/pnas.1617244114. Epub 2017 Feb 6.
22	Metformin paradoxically worsens insulin resistance in SHORT syndrome.Diabetol Metab Syndr. 2019 Oct 1;11:81. doi: 10.1186/s13098-019-0477-z. eCollection 2019.
23	Insulin growth factor signaling is regulated by microRNA-486, an underexpressed microRNA in lung cancer.Proc Natl Acad Sci U S A. 2013 Sep 10;110(37):15043-8. doi: 10.1073/pnas.1307107110. Epub 2013 Aug 26.
24	PI3K oncogenic mutations mediate resistance to afatinib in HER2/neu overexpressing gynecological cancers.Gynecol Oncol. 2019 Apr;153(1):158-164. doi: 10.1016/j.ygyno.2019.01.002. Epub 2019 Jan 7.
25	Sequencing of prostate cancers identifies new cancer genes, routes of progression and drug targets.Nat Genet. 2018 May;50(5):682-692. doi: 10.1038/s41588-018-0086-z. Epub 2018 Apr 16.
26	Iris Malformation and Anterior Segment Dysgenesis in Mice and Humans With a Mutation in PI 3-Kinase.Invest Ophthalmol Vis Sci. 2017 Jun 1;58(7):3100-3106. doi: 10.1167/iovs.16-21347.
27	Candidate gene association study in type 2 diabetes indicates a role for genes involved in beta-cell function as well as insulin action.PLoS Biol. 2003 Oct;1(1):E20. doi: 10.1371/journal.pbio.0000020. Epub 2003 Oct 13.
28	Reduced Nrf2 activation in PI3K phosphorylation-impaired vitiliginous keratinocytes increases susceptibility to ROS-generating chemical-induced apoptosis.Environ Toxicol. 2017 Dec;32(12):2481-2491. doi: 10.1002/tox.22461. Epub 2017 Aug 24.
29	The genetic landscape of mutations in Burkitt lymphoma.Nat Genet. 2012 Dec;44(12):1321-5. doi: 10.1038/ng.2468. Epub 2012 Nov 11.
30	PIK3R1 gene polymorphisms are associated with type 2 diabetes and related features in the Turkish population.Adv Clin Exp Med. 2018 Jul;27(7):921-927. doi: 10.17219/acem/68985.
31	A human immunodeficiency caused by mutations in the PIK3R1 gene. J Clin Invest. 2014 Sep;124(9):3923-8. doi: 10.1172/JCI75746. Epub 2014 Aug 18.
32	Chronic blockade of phosphatidylinositol 3-kinase in the nucleus tractus solitarii is prohypertensive in the spontaneously hypertensive rat.Hypertension. 2009 Jan;53(1):97-103. doi: 10.1161/HYPERTENSIONAHA.108.122341. Epub 2008 Nov 17.
33	Allelic imbalance and altered expression of genes in chromosome 2q11-2q16 from rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine.Oncogene. 2003 Feb 27;22(8):1253-60. doi: 10.1038/sj.onc.1206233.
34	Genomic profiling of metaplastic breast carcinomas reveals genetic heterogeneity and relationship to ductal carcinoma.Mod Pathol. 2018 Nov;31(11):1661-1674. doi: 10.1038/s41379-018-0081-z. Epub 2018 Jun 26.
35	Anticancer activity of Schiff base-Poloxamer P85 combination against kidney cancer.Int Urol Nephrol. 2018 Feb;50(2):247-255. doi: 10.1007/s11255-017-1782-9. Epub 2017 Dec 29.
36	MiR-486-5p Serves as a Good Biomarker in Nonsmall Cell Lung Cancer and Suppresses Cell Growth With the Involvement of a Target PIK3R1.Front Genet. 2019 Jul 26;10:688. doi: 10.3389/fgene.2019.00688. eCollection 2019.
37	Phosphatidylinositol 3-kinase/Akt signaling stimulates colonic mucosal cell survival during aging.Am J Physiol Gastrointest Liver Physiol. 2006 Jan;290(1):G49-55. doi: 10.1152/ajpgi.00106.2005. Epub 2005 Aug 25.
38	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
39	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
40	Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
41	Gene expression data from acetaminophen-induced toxicity in human hepatic in vitro systems and clinical liver samples. Data Brief. 2016 Mar 26;7:1052-1057. doi: 10.1016/j.dib.2016.03.069. eCollection 2016 Jun.
42	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
43	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
44	Genome-wide analysis of BEAS-2B cells exposed to trivalent arsenicals and dimethylthioarsinic acid. Toxicology. 2010 Jan 31;268(1-2):31-9.
45	Anticarcinogenic action of quercetin by downregulation of phosphatidylinositol 3-kinase (PI3K) and protein kinase C (PKC) via induction of p53 in hepatocellular carcinoma (HepG2) cell line. Mol Biol Rep. 2015 Sep;42(9):1419-29. doi: 10.1007/s11033-015-3921-7. Epub 2015 Aug 27.
46	Arsenic trioxide reduces the expression of E2F1, cyclin E, and phosphorylation of PI3K signaling molecules in acute leukemia cells. Environ Toxicol. 2021 Sep;36(9):1785-1792. doi: 10.1002/tox.23299. Epub 2021 May 27.
47	Repression of Kisspeptin1 weakens hydrogen peroxide-caused injury in HTR8 cells via adjusting PI3K/AKT/mTOR pathway. J Biochem Mol Toxicol. 2020 May;34(5):e22461. doi: 10.1002/jbt.22461. Epub 2020 Feb 11.
48	The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
49	Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
50	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
51	Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
52	Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
53	Regulation of gene expression by activation of the peroxisome proliferator-activated receptor gamma with rosiglitazone (BRL 49653) in human adipocytes. Biochem Biophys Res Commun. 1999 Nov;265(1):265-71. doi: 10.1006/bbrc.1999.1657.
54	Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
55	Combination of arsenic trioxide and Dasatinib: a new strategy to treat Philadelphia chromosome-positive acute lymphoblastic leukaemia. J Cell Mol Med. 2018 Mar;22(3):1614-1626.
56	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
57	Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
58	Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
59	A systems biology understanding of the synergistic effects of arsenic sulfide and Imatinib in BCR/ABL-associated leukemia. Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3378-83.
60	Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
61	Cantharidin suppresses gastric cancer cell migration/invasion by inhibiting the PI3K/Akt signaling pathway via CCAT1. Chem Biol Interact. 2020 Feb 1;317:108939. doi: 10.1016/j.cbi.2020.108939. Epub 2020 Jan 13.
62	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
63	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
64	Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
65	Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
66	Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
67	Improved Preventive Effects of Combined Bioactive Compounds Present in Different Blueberry Varieties as Compared to Single Phytochemicals. Nutrients. 2018 Dec 29;11(1):61. doi: 10.3390/nu11010061.
68	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
69	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
70	Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
71	The Specific Inhibition of SOD1 Selectively Promotes Apoptosis of Cancer Cells via Regulation of the ROS Signaling Network. Oxid Med Cell Longev. 2019 Feb 18;2019:9706792. doi: 10.1155/2019/9706792. eCollection 2019.
72	Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
73	Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
74	Expression and purification of PI3 kinase alpha and development of an ATP depletion and an alphascreen PI3 kinase activity assay. J Biomol Screen. 2008 Dec;13(10):1035-40. doi: 10.1177/1087057108326079. Epub 2008 Nov 25.
75	Farnesyltransferase inhibitor, ABT-100, is a potent liver cancer chemopreventive agent. Clin Cancer Res. 2005 Jun 1;11(11):4266-74. doi: 10.1158/1078-0432.CCR-04-2386.
76	Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
77	Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
78	Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
79	Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
80	Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
81	Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
82	Danhong formula alleviates endothelial dysfunction and reduces blood pressure in hypertension by regulating MicroRNA 24 - Phosphatidylinositol 3-Kinase-Serine/Threonine Kinase- Endothelial Nitric Oxide Synthase axis. J Ethnopharmacol. 2024 Apr 6;323:117615. doi: 10.1016/j.jep.2023.117615. Epub 2023 Dec 30.
83	HDAC4-regulated STAT1 activation mediates platinum resistance in ovarian cancer. Cancer Res. 2011 Jul 1;71(13):4412-22. doi: 10.1158/0008-5472.CAN-10-4111. Epub 2011 May 13.
84	Mapping genes that contribute to daunorubicin-induced cytotoxicity. Cancer Res. 2007 Jun 1;67(11):5425-33. doi: 10.1158/0008-5472.CAN-06-4431.