Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHQFQF7)

DOT Name Rho-related GTP-binding protein RhoB (RHOB)
Synonyms Rho cDNA clone 6; h6
Gene Name RHOB
UniProt ID
RHOB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2FV8; 6HXU; 6SGE
Pfam ID
PF00071
Sequence
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD
LRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ
KRYGSQNGCINCCKVL
Function
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
KEGG Pathway
Salmonella infection (hsa05132 )
Reactome Pathway
G alpha (12/13) signalling events (R-HSA-416482 )
Sema4D induced cell migration and growth-cone collapse (R-HSA-416572 )
RHO GTPases activate PKNs (R-HSA-5625740 )
RHO GTPases activate CIT (R-HSA-5625900 )
RHO GTPases Activate ROCKs (R-HSA-5627117 )
RHO GTPases Activate Formins (R-HSA-5663220 )
RHO GTPases Activate Rhotekin and Rhophilins (R-HSA-5666185 )
RHOB GTPase cycle (R-HSA-9013026 )
GPVI-mediated activation cascade (R-HSA-114604 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
50 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [6]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [8]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [9]
Triclosan DMZUR4N Approved Triclosan increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [10]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Rho-related GTP-binding protein RhoB (RHOB). [11]
Marinol DM70IK5 Approved Marinol increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [12]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [13]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Rho-related GTP-binding protein RhoB (RHOB). [14]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [9]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [3]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [15]
Ethanol DMDRQZU Approved Ethanol decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [16]
Irinotecan DMP6SC2 Approved Irinotecan increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [17]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Rho-related GTP-binding protein RhoB (RHOB). [11]
Clozapine DMFC71L Approved Clozapine increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [18]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [19]
Menthol DMG2KW7 Approved Menthol increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [20]
Alitretinoin DMME8LH Approved Alitretinoin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [3]
Terbinafine DMI6HUW Approved Terbinafine decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [22]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [23]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [24]
Rigosertib DMOSTXF Phase 3 Rigosertib increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [25]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [26]
Chloroquine DMSI5CB Phase 3 Trial Chloroquine increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [18]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [28]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [29]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [30]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [31]
Perillyl alcohol DMFWC3O Discontinued in Phase 2 Perillyl alcohol increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [20]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [32]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [33]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [34]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [35]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [36]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [37]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [38]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [39]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [40]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [41]
all-trans-4-oxo-retinoic acid DMM2R1N Investigative all-trans-4-oxo-retinoic acid decreases the expression of Rho-related GTP-binding protein RhoB (RHOB). [3]
Perillaldehyde DMZA0VD Investigative Perillaldehyde increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [20]
dihydrocarveol DMS4U68 Investigative dihydrocarveol increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [20]
carveol DMGIZ5U Investigative carveol increases the expression of Rho-related GTP-binding protein RhoB (RHOB). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Lovastatin DM9OZWQ Approved Lovastatin decreases the prenylation of Rho-related GTP-binding protein RhoB (RHOB). [21]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Rho-related GTP-binding protein RhoB (RHOB). [27]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 Grouping of histone deacetylase inhibitors and other toxicants disturbing neural crest migration by transcriptional profiling. Neurotoxicology. 2015 Sep;50:56-70.
9 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
10 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
11 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
12 JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
13 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
14 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
15 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
16 Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
17 Gene expression profile of colon cancer cell lines treated with SN-38. Chemotherapy. 2010;56(1):17-25. doi: 10.1159/000287353. Epub 2010 Feb 24.
18 Toxicoproteomics reveals an effect of clozapine on autophagy in human liver spheroids. Toxicol Mech Methods. 2023 Jun;33(5):401-410. doi: 10.1080/15376516.2022.2156005. Epub 2022 Dec 19.
19 Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
20 Monoterpene regulation of Ras and Ras-related protein expression. J Lipid Res. 2003 Jun;44(6):1209-15. doi: 10.1194/jlr.M300057-JLR200. Epub 2003 Apr 1.
21 Combining prenylation inhibitors causes synergistic cytotoxicity, apoptosis and disruption of RAS-to-MAP kinase signalling in multiple myeloma cells. Br J Haematol. 2005 Sep;130(6):912-25. doi: 10.1111/j.1365-2141.2005.05696.x.
22 Terbinafine inhibits endothelial cell migration through suppression of the Rho-mediated pathway. Mol Cancer Ther. 2006 Dec;5(12):3130-8. doi: 10.1158/1535-7163.MCT-06-0457.
23 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
24 Novel carbocyclic curcumin analog CUR3d modulates genes involved in multiple apoptosis pathways in human hepatocellular carcinoma cells. Chem Biol Interact. 2015 Dec 5;242:107-22.
25 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
26 Combination of atorvastatin and celecoxib synergistically induces cell cycle arrest and apoptosis in colon cancer cells. Int J Cancer. 2008 May 1;122(9):2115-24. doi: 10.1002/ijc.23315.
27 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
28 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
29 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
30 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
31 Torcetrapib induces aldosterone and cortisol production by an intracellular calcium-mediated mechanism independently of cholesteryl ester transfer protein inhibition. Endocrinology. 2009 May;150(5):2211-9.
32 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
33 Epigenetic regulation of RhoB loss of expression in lung cancer. BMC Cancer. 2007 Nov 30;7:220. doi: 10.1186/1471-2407-7-220.
34 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
35 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
36 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
37 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
38 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
39 Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
40 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
41 Gallic acid inhibits gastric cancer cells metastasis and invasive growth via increased expression of RhoB, downregulation of AKT/small GTPase signals and inhibition of NF-B activity. Toxicol Appl Pharmacol. 2013 Jan 1;266(1):76-85. doi: 10.1016/j.taap.2012.10.019. Epub 2012 Nov 13.