Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJFOR67)

DOT Name Amphiregulin (AREG)
Synonyms AR; Colorectum cell-derived growth factor; CRDGF
Gene Name AREG
UniProt ID
AREG_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2RNL
Sequence
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
LRQENGNVHAIA
Function Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
ErbB sig.ling pathway (hsa04012 )
PI3K-Akt sig.ling pathway (hsa04151 )
Hippo sig.ling pathway (hsa04390 )
Colorectal cancer (hsa05210 )
Reactome Pathway
Signaling by EGFR (R-HSA-177929 )
GRB2 events in EGFR signaling (R-HSA-179812 )
GAB1 signalosome (R-HSA-180292 )
SHC1 events in EGFR signaling (R-HSA-180336 )
EGFR downregulation (R-HSA-182971 )
COPII-mediated vesicle transport (R-HSA-204005 )
EGFR interacts with phospholipase C-gamma (R-HSA-212718 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Inhibition of Signaling by Overexpressed EGFR (R-HSA-5638303 )
RAF/MAP kinase cascade (R-HSA-5673001 )
Cargo concentration in the ER (R-HSA-5694530 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )
Clathrin-mediated endocytosis (R-HSA-8856828 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
NFE2L2 regulating tumorigenic genes (R-HSA-9818030 )
PIP3 activates AKT signaling (R-HSA-1257604 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Gemcitabine DMSE3I7 Approved Amphiregulin (AREG) decreases the response to substance of Gemcitabine. [7]
Gefitinib DM15F0X Approved Amphiregulin (AREG) decreases the response to substance of Gefitinib. [48]
------------------------------------------------------------------------------------
52 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Amphiregulin (AREG). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Amphiregulin (AREG). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Amphiregulin (AREG). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Amphiregulin (AREG). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Amphiregulin (AREG). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Amphiregulin (AREG). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Amphiregulin (AREG). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Amphiregulin (AREG). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Amphiregulin (AREG). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Amphiregulin (AREG). [10]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Amphiregulin (AREG). [11]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Amphiregulin (AREG). [12]
Marinol DM70IK5 Approved Marinol decreases the expression of Amphiregulin (AREG). [13]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Amphiregulin (AREG). [14]
Progesterone DMUY35B Approved Progesterone increases the expression of Amphiregulin (AREG). [15]
Menadione DMSJDTY Approved Menadione increases the expression of Amphiregulin (AREG). [9]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Amphiregulin (AREG). [16]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the expression of Amphiregulin (AREG). [17]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Amphiregulin (AREG). [18]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Amphiregulin (AREG). [19]
Etoposide DMNH3PG Approved Etoposide increases the expression of Amphiregulin (AREG). [20]
Irinotecan DMP6SC2 Approved Irinotecan increases the expression of Amphiregulin (AREG). [21]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Amphiregulin (AREG). [22]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of Amphiregulin (AREG). [7]
Estrone DM5T6US Approved Estrone increases the expression of Amphiregulin (AREG). [19]
Dinoprostone DMTYOPD Approved Dinoprostone increases the expression of Amphiregulin (AREG). [24]
Mestranol DMG3F94 Approved Mestranol increases the expression of Amphiregulin (AREG). [19]
Exemestane DM9HPW3 Approved Exemestane increases the expression of Amphiregulin (AREG). [26]
Seocalcitol DMKL9QO Phase 3 Seocalcitol increases the expression of Amphiregulin (AREG). [27]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine decreases the expression of Amphiregulin (AREG). [28]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Amphiregulin (AREG). [29]
Afimoxifene DMFORDT Phase 2 Afimoxifene decreases the expression of Amphiregulin (AREG). [30]
ANW-32821 DMMJOZD Phase 2 ANW-32821 increases the expression of Amphiregulin (AREG). [31]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Amphiregulin (AREG). [32]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Amphiregulin (AREG). [33]
HEXESTROL DM9AGWQ Withdrawn from market HEXESTROL increases the expression of Amphiregulin (AREG). [19]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Amphiregulin (AREG). [29]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Amphiregulin (AREG). [1]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Amphiregulin (AREG). [35]
Milchsaure DM462BT Investigative Milchsaure affects the expression of Amphiregulin (AREG). [36]
Forskolin DM6ITNG Investigative Forskolin increases the expression of Amphiregulin (AREG). [24]
CH-223191 DMMJZYC Investigative CH-223191 decreases the expression of Amphiregulin (AREG). [38]
Bilirubin DMI0V4O Investigative Bilirubin increases the expression of Amphiregulin (AREG). [39]
Nitrobenzanthrone DMN6L70 Investigative Nitrobenzanthrone increases the expression of Amphiregulin (AREG). [40]
Cycloheximide DMGDA3C Investigative Cycloheximide increases the expression of Amphiregulin (AREG). [41]
OXYBENZONE DMMZYX6 Investigative OXYBENZONE increases the expression of Amphiregulin (AREG). [43]
Isoarnebin 4 DM0B7NO Investigative Isoarnebin 4 decreases the expression of Amphiregulin (AREG). [44]
Ginsenoside RG3 DMFN58T Investigative Ginsenoside RG3 decreases the expression of Amphiregulin (AREG). [45]
All-trans-retinal DM6CEVB Investigative All-trans-retinal increases the expression of Amphiregulin (AREG). [3]
ROLIPRAM DMJ03UM Investigative ROLIPRAM increases the expression of Amphiregulin (AREG). [24]
isobutylmethylxanthine DM46F5X Investigative isobutylmethylxanthine increases the expression of Amphiregulin (AREG). [24]
Hydroxybenzo(a)pyrene DM9H5EN Investigative Hydroxybenzo(a)pyrene increases the expression of Amphiregulin (AREG). [46]
------------------------------------------------------------------------------------
⏷ Show the Full List of 52 Drug(s)
8 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the secretion of Amphiregulin (AREG). [23]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid increases the secretion of Amphiregulin (AREG). [25]
Batimastat DM92VRP Preclinical Batimastat decreases the secretion of Amphiregulin (AREG). [34]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the secretion of Amphiregulin (AREG). [37]
U0126 DM31OGF Investigative U0126 decreases the secretion of Amphiregulin (AREG). [42]
PD-158780 DMQXYE9 Investigative PD-158780 decreases the secretion of Amphiregulin (AREG). [42]
SU 6656 DMF1P6W Investigative SU 6656 decreases the secretion of Amphiregulin (AREG). [42]
Pervanadate DM873BS Investigative Pervanadate increases the cleavage of Amphiregulin (AREG). [47]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
2 Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
3 Retinoid-induced epidermal hyperplasia is mediated by epidermal growth factor receptor activation via specific induction of its ligands heparin-binding EGF and amphiregulin in human skin in vivo. J Invest Dermatol. 2006 Apr;126(4):732-9. doi: 10.1038/sj.jid.5700202.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Amphiregulin regulates the activation of ERK and Akt through epidermal growth factor receptor and HER3 signals involved in the progression of pancreatic cancer. Cancer Sci. 2010 Nov;101(11):2351-60. doi: 10.1111/j.1349-7006.2010.01671.x.
8 The effects of beta-estradiol on Raf activity, cell cycle progression and growth factor synthesis in the MCF-7 breast cancer cell line. Cancer Biol Ther. 2002 May-Jun;1(3):256-62. doi: 10.4161/cbt.77.
9 Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
10 Amphiregulin is a vitamin D3 target gene in squamous cell and breast carcinoma. Biochem Biophys Res Commun. 2001 Mar 9;281(4):1051-6. doi: 10.1006/bbrc.2001.4466.
11 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
12 Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
13 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
14 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
15 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
16 Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
17 Analysis of estrogen agonism and antagonism of tamoxifen, raloxifene, and ICI182780 in endometrial cancer cells: a putative role for the epidermal growth factor receptor ligand amphiregulin. J Soc Gynecol Investig. 2005 Oct;12(7):e55-67.
18 Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
19 Moving toward integrating gene expression profiling into high-throughput testing: a gene expression biomarker accurately predicts estrogen receptor alpha modulation in a microarray compendium. Toxicol Sci. 2016 May;151(1):88-103.
20 The DNA damaging agent VP16 induces the expression of a subset of ligands from the EGF system in bladder cancer cells, whereas none of the four EGF receptors are induced. Mol Cell Biochem. 2004 May;260(1-2):129-35. doi: 10.1023/b:mcbi.0000026063.96267.98.
21 Gefitinib ("Iressa", ZD1839) inhibits SN38-triggered EGF signals and IL-8 production in gastric cancer cells. Cancer Chemother Pharmacol. 2005 Apr;55(4):393-403. doi: 10.1007/s00280-004-0904-0. Epub 2004 Oct 5.
22 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
23 Human skin in organ culture and human skin cells (keratinocytes and fibroblasts) in monolayer culture for assessment of chemically induced skin damage. Toxicol Pathol. 2007 Aug;35(5):693-701. doi: 10.1080/01926230701481907.
24 The epidermal growth factor-like growth factor amphiregulin is strongly induced by the adenosine 3',5'-monophosphate pathway in various cell types. Endocrinology. 2004 Nov;145(11):5177-84. doi: 10.1210/en.2004-0232. Epub 2004 Jul 29.
25 Ligand-dependent activation of the epidermal growth factor receptor by secondary bile acids in polarizing colon cancer cells. Surgery. 2005 Sep;138(3):415-21. doi: 10.1016/j.surg.2005.06.030.
26 Characterization of the weak estrogen receptor alpha agonistic activity of exemestane. Breast Cancer Res Treat. 2009 Aug;116(3):461-70. doi: 10.1007/s10549-008-0151-x. Epub 2008 Aug 3.
27 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
28 Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
29 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
30 Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
31 Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses. J Biol Chem. 2015 Oct 16;290(42):25322-32. doi: 10.1074/jbc.M115.645234. Epub 2015 Aug 20.
32 Gene expression profiling in Caco-2 human colon cells exposed to TCDD, benzo[a]pyrene, and natural Ah receptor agonists from cruciferous vegetables and citrus fruits. Toxicol In Vitro. 2008 Mar;22(2):396-410.
33 The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
34 Role of EGF receptor ligands in TCDD-induced EGFR down-regulation and cellular proliferation. Chem Biol Interact. 2016 Jun 25;253:38-47. doi: 10.1016/j.cbi.2016.04.031. Epub 2016 Apr 23.
35 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
36 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
37 Effects of Agricultural Organic Dusts on Human Lung-Resident Mesenchymal Stem (Stromal) Cell Function. Toxicol Sci. 2018 Apr 1;162(2):635-644. doi: 10.1093/toxsci/kfx286.
38 The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
39 Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
40 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
41 Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
42 Src family kinase inhibitors block amphiregulin-mediated autocrine ErbB signaling in normal human keratinocytes. Mol Pharmacol. 2005 Apr;67(4):1145-57. doi: 10.1124/mol.104.004689. Epub 2004 Dec 22.
43 Effects of Benzophenone-3 and Propylparaben on Estrogen Receptor-Dependent R-Loops and DNA Damage in Breast Epithelial Cells and Mice. Environ Health Perspect. 2020 Jan;128(1):17002. doi: 10.1289/EHP5221. Epub 2020 Jan 15.
44 Shikonin suppresses small cell lung cancer growth via inducing ATF3-mediated ferroptosis to promote ROS accumulation. Chem Biol Interact. 2023 Sep 1;382:110588. doi: 10.1016/j.cbi.2023.110588. Epub 2023 Jun 1.
45 Ginsenoside Rg3 attenuates the osimertinib resistance by reducing the stemness of non-small cell lung cancer cells. Environ Toxicol. 2020 Jun;35(6):643-651. doi: 10.1002/tox.22899. Epub 2020 Jan 9.
46 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
47 Tyrosine phosphorylation and proteolysis. Pervanadate-induced, metalloprotease-dependent cleavage of the ErbB-4 receptor and amphiregulin. J Biol Chem. 1998 Aug 7;273(32):20589-95. doi: 10.1074/jbc.273.32.20589.
48 Prediction of sensitivity of advanced non-small cell lung cancers to gefitinib (Iressa, ZD1839). Hum Mol Genet. 2004 Dec 15;13(24):3029-43. doi: 10.1093/hmg/ddh331. Epub 2004 Oct 20.