Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP74K37)

DOT Name Vascular cell adhesion protein 1
Synonyms V-CAM 1; VCAM-1; INCAM-100; CD antigen CD106
Gene Name VCAM1
UniProt ID
VCAM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1IJ9; 1VCA; 1VSC
Pfam ID
PF05790 ; PF07679 ; PF00047 ; PF13927
Sequence
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
Function
Cell adhesion glycoprotein predominantly expressed on the surface of endothelial cells that plays an important role in immune surveillance and inflammation. Acts as a major regulator of leukocyte adhesion to the endothelium through interaction with different types of integrins. During inflammatory responses, binds ligands on the surface of activated endothelial cells to initiate the activation of calcium channels and the plasma membrane-associated small GTPase RAC1 leading to leukocyte transendothelial migration. Serves also as a quality-control checkpoint for entry into bone marrow by providing a 'don't-eat-me' stamping in the context of major histocompatibility complex (MHC) class-I presentation.
Tissue Specificity Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue.
KEGG Pathway
NF-kappa B sig.ling pathway (hsa04064 )
Cell adhesion molecules (hsa04514 )
TNF sig.ling pathway (hsa04668 )
Leukocyte transendothelial migration (hsa04670 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
African trypanosomiasis (hsa05143 )
Malaria (hsa05144 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
Integrin cell surface interactions (R-HSA-216083 )
Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
Interferon gamma signaling (R-HSA-877300 )
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Etoposide DMNH3PG Approved Vascular cell adhesion protein 1 decreases the response to substance of Etoposide. [50]
Paclitaxel DMLB81S Approved Vascular cell adhesion protein 1 affects the response to substance of Paclitaxel. [51]
------------------------------------------------------------------------------------
61 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Vascular cell adhesion protein 1. [1]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Vascular cell adhesion protein 1. [2]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Vascular cell adhesion protein 1. [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Vascular cell adhesion protein 1. [4]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Vascular cell adhesion protein 1. [5]
Quercetin DM3NC4M Approved Quercetin increases the expression of Vascular cell adhesion protein 1. [6]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Vascular cell adhesion protein 1. [7]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Vascular cell adhesion protein 1. [8]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Vascular cell adhesion protein 1. [9]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Vascular cell adhesion protein 1. [10]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Vascular cell adhesion protein 1. [11]
Progesterone DMUY35B Approved Progesterone increases the expression of Vascular cell adhesion protein 1. [12]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Vascular cell adhesion protein 1. [13]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Vascular cell adhesion protein 1. [14]
Cytarabine DMZD5QR Approved Cytarabine increases the expression of Vascular cell adhesion protein 1. [15]
Aspirin DM672AH Approved Aspirin decreases the expression of Vascular cell adhesion protein 1. [16]
Nicotine DMWX5CO Approved Nicotine increases the expression of Vascular cell adhesion protein 1. [17]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of Vascular cell adhesion protein 1. [18]
Gemcitabine DMSE3I7 Approved Gemcitabine decreases the expression of Vascular cell adhesion protein 1. [19]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Vascular cell adhesion protein 1. [20]
Sertraline DM0FB1J Approved Sertraline increases the expression of Vascular cell adhesion protein 1. [21]
Chenodiol DMQ8JIK Approved Chenodiol increases the expression of Vascular cell adhesion protein 1. [22]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid increases the expression of Vascular cell adhesion protein 1. [22]
Fructose DM43AN2 Approved Fructose increases the expression of Vascular cell adhesion protein 1. [23]
Sulfasalazine DMICA9H Approved Sulfasalazine decreases the expression of Vascular cell adhesion protein 1. [24]
Epanova DMHEAGL Approved Epanova decreases the expression of Vascular cell adhesion protein 1. [25]
Erythromycin DM4K7GQ Approved Erythromycin increases the expression of Vascular cell adhesion protein 1. [26]
Tibolone DM78XFG Approved Tibolone decreases the expression of Vascular cell adhesion protein 1. [27]
Dutasteride DMQ4TJK Approved Dutasteride increases the expression of Vascular cell adhesion protein 1. [28]
Hesperidin DMI5DW1 Approved Hesperidin decreases the expression of Vascular cell adhesion protein 1. [30]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Vascular cell adhesion protein 1. [31]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Vascular cell adhesion protein 1. [6]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin decreases the expression of Vascular cell adhesion protein 1. [18]
HMPL-004 DM29XGY Phase 3 HMPL-004 increases the expression of Vascular cell adhesion protein 1. [32]
Bardoxolone methyl DMODA2X Phase 3 Bardoxolone methyl increases the expression of Vascular cell adhesion protein 1. [32]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Vascular cell adhesion protein 1. [33]
Taurocholic acid DM2LZ8F Phase 1/2 Taurocholic acid decreases the expression of Vascular cell adhesion protein 1. [34]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Vascular cell adhesion protein 1. [35]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Vascular cell adhesion protein 1. [36]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of Vascular cell adhesion protein 1. [37]
Acteoside DM0YHKB Terminated Acteoside decreases the expression of Vascular cell adhesion protein 1. [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Vascular cell adhesion protein 1. [38]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Vascular cell adhesion protein 1. [39]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Vascular cell adhesion protein 1. [40]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Vascular cell adhesion protein 1. [32]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Vascular cell adhesion protein 1. [41]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the expression of Vascular cell adhesion protein 1. [42]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Vascular cell adhesion protein 1. [43]
Dibutyl phthalate DMEDGKO Investigative Dibutyl phthalate decreases the expression of Vascular cell adhesion protein 1. [44]
Chrysin DM7V2LG Investigative Chrysin increases the expression of Vascular cell adhesion protein 1. [37]
2-tert-butylbenzene-1,4-diol DMNXI1E Investigative 2-tert-butylbenzene-1,4-diol increases the expression of Vascular cell adhesion protein 1. [32]
DM9CEI5 increases the expression of Vascular cell adhesion protein 1. [22]
27-hydroxycholesterol DM2L6OZ Investigative 27-hydroxycholesterol increases the expression of Vascular cell adhesion protein 1. [45]
GW-3965 DMG60ET Investigative GW-3965 increases the expression of Vascular cell adhesion protein 1. [45]
T0901317 DMZQVDI Investigative T0901317 increases the expression of Vascular cell adhesion protein 1. [45]
CHLORANIL DMCHGF1 Investigative CHLORANIL increases the expression of Vascular cell adhesion protein 1. [46]
Naringin DM4DG1Y Investigative Naringin decreases the expression of Vascular cell adhesion protein 1. [47]
25-hydroxycholesterol DMCHAQ7 Investigative 25-hydroxycholesterol increases the expression of Vascular cell adhesion protein 1. [45]
Sulfate DMW0ZBF Investigative Sulfate affects the expression of Vascular cell adhesion protein 1. [48]
Lysophosphatidylcholine DMOGFVH Investigative Lysophosphatidylcholine increases the expression of Vascular cell adhesion protein 1. [49]
24(S), 25-epoxycholesterol DMW2KI5 Investigative 24(S), 25-epoxycholesterol increases the expression of Vascular cell adhesion protein 1. [45]
------------------------------------------------------------------------------------
⏷ Show the Full List of 61 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fluticasone propionate DMRWLB2 Approved Fluticasone propionate decreases the stability of Vascular cell adhesion protein 1. [29]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Coronaric thrombotic events in acute promyelocytic leukemia during all-trans retinoic acid treatment: a role for adhesion molecules overexpression?. Leukemia. 1999 Feb;13(2):312-3. doi: 10.1038/sj.leu.2401273.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Copper induces--and copper chelation by tetrathiomolybdate inhibits--endothelial activation in vitro. Redox Rep. 2014 Jan;19(1):40-8. doi: 10.1179/1351000213Y.0000000070. Epub 2013 Nov 12.
5 Increases in oxidized low-density lipoprotein and other inflammatory and adhesion molecules with a concomitant decrease in high-density lipoprotein in the individuals exposed to arsenic in Bangladesh. Toxicol Sci. 2013 Sep;135(1):17-25. doi: 10.1093/toxsci/kft130. Epub 2013 Jun 12.
6 Antioxidant and signal modulation properties of plant polyphenols in controlling vascular inflammation. Eur J Pharmacol. 2011 May 11;658(2-3):248-56.
7 Arsenic and fluoride induce apoptosis, inflammation and oxidative stress in cultured human umbilical vein endothelial cells. Chemosphere. 2017 Jan;167:454-461. doi: 10.1016/j.chemosphere.2016.10.025. Epub 2016 Oct 14.
8 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
9 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
10 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
11 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
12 Effect of ovarian steroids on gene expression profile in human uterine microvascular endothelial cells. Fertil Steril. 2009 Aug;92(2):709-21.
13 NF-kappaB activation for constitutive expression of VCAM-1 and ICAM-1 on B lymphocytes and plasma cells. Biochem Biophys Res Commun. 2001 Dec 14;289(4):851-6. doi: 10.1006/bbrc.2001.6067.
14 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
15 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
16 Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
17 Nicotine induced changes in gene expression by human coronary artery endothelial cells. Atherosclerosis. 2001 Feb 1;154(2):277-83.
18 Simvastatin reduces VCAM-1 expression in human umbilical vein endothelial cells exposed to lipopolysaccharide. Inflamm Res. 2012 May;61(5):485-91. doi: 10.1007/s00011-012-0435-9. Epub 2012 Jan 15.
19 Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
20 VCAM-1 expression on human dermal microvascular endothelial cells is directly and specifically up-regulated by substance P. J Immunol. 1999 Feb 1;162(3):1656-61.
21 Relationship between release of platelet/endothelial biomarkers and plasma levels of sertraline and N-desmethylsertraline in acute coronary syndrome patients receiving SSRI treatment for depression. Am J Psychiatry. 2005 Jun;162(6):1165-70. doi: 10.1176/appi.ajp.162.6.1165.
22 Bile acids induce adhesion molecule expression in endothelial cells through activation of reactive oxygen species, NF-kappaB, and p38. Am J Physiol Heart Circ Physiol. 2006 Aug;291(2):H741-7. doi: 10.1152/ajpheart.01182.2005. Epub 2006 Mar 31.
23 Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
24 [The effects of anti-inflammatory on activation of nuclear factor-kappaB and expression of cell adhesion molecules in patients with ulcerative colitis]. Sheng Wu Yi Xue Gong Cheng Xue Za Zhi. 2004 Oct;21(5):732-6.
25 Docosahexaenoic and eicosapentaenoic acids inhibit in vitro human lymphocyte-endothelial cell adhesion. Transplantation. 1996 Dec 15;62(11):1649-57. doi: 10.1097/00007890-199612150-00020.
26 The in vitro effects of quinupristin/dalfopristin, erythromycin and levofloxacin at low concentrations on the expression of different cell adhesion molecules on the surface of endothelial cells (Eahy926). Toxicology. 2006 Jan 20;218(1):30-8. doi: 10.1016/j.tox.2005.09.014. Epub 2005 Nov 16.
27 Effects of hormone treatment on hemostasis variables. Climacteric. 2007 Oct;10 Suppl 2:32-7. doi: 10.1080/13697130701598548.
28 Effects of dutasteride on the expression of genes related to androgen metabolism and related pathway in human prostate cancer cell lines. Invest New Drugs. 2007 Oct;25(5):491-7.
29 Inhibition of VCAM-1 expression in human bronchial epithelial cells by glucocorticoids. Am J Respir Cell Mol Biol. 1999 Apr;20(4):643-50. doi: 10.1165/ajrcmb.20.4.3265.
30 The effect of hesperidin supplementation on inflammatory markers in human adults: A systematic review and meta-analysis of randomized controlled clinical trials. Chem Biol Interact. 2019 Jul 1;307:8-15. doi: 10.1016/j.cbi.2019.04.016. Epub 2019 Apr 13.
31 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
32 Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
33 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
34 Cholestatic pregnancy is associated with reduced VCAM1 expression in vascular endothelial cell of placenta. Reprod Toxicol. 2017 Dec;74:23-31. doi: 10.1016/j.reprotox.2017.08.002. Epub 2017 Aug 26.
35 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
36 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
37 A p38-p65 transcription complex induced by endothelin-1 mediates signal transduction in cancer cells. Biochim Biophys Acta. 2008 Sep;1783(9):1613-22.
38 Biological effects of chronic and acute exposure of human endothelial cell line EA.hy926 to bisphenol A: New tricks from an old dog. Chemosphere. 2020 Oct;256:127159. doi: 10.1016/j.chemosphere.2020.127159. Epub 2020 May 21.
39 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
40 Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
41 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
42 Palmitate-induced endothelial dysfunction is attenuated by cyanidin-3-O-glucoside through modulation of Nrf2/Bach1 and NF-B pathways. Toxicol Lett. 2015 Dec 15;239(3):152-60.
43 Intermittent high glucose enhances ICAM-1, VCAM-1, E-selectin and interleukin-6 expression in human umbilical endothelial cells in culture: the role of poly(ADP-ribose) polymerase. J Thromb Haemost. 2004 Aug;2(8):1453-9. doi: 10.1111/j.1538-7836.2004.00835.x.
44 Integration of data from the in vitro long-term exposure study on human endothelial cells and the in silico analysis: A case of dibutyl phthalate-induced vascular dysfunction. Toxicol Lett. 2022 Mar 1;356:64-74. doi: 10.1016/j.toxlet.2021.12.006. Epub 2021 Dec 10.
45 LXR-activating oxysterols induce the expression of inflammatory markers in endothelial cells through LXR-independent mechanisms. Atherosclerosis. 2009 Nov;207(1):38-44.
46 Tetrachlorobenzoquinone Stimulates NLRP3 Inflammasome-Mediated Post-Translational Activation and Secretion of IL-1 in the HUVEC Endothelial Cell Line. Chem Res Toxicol. 2016 Mar 21;29(3):421-9. doi: 10.1021/acs.chemrestox.6b00021. Epub 2016 Mar 1.
47 Naringin suppress chondrosarcoma migration through inhibition vascular adhesion molecule-1 expression by modulating miR-126. Int Immunopharmacol. 2014 Sep;22(1):107-14. doi: 10.1016/j.intimp.2014.06.029. Epub 2014 Jun 26.
48 Ambient pollutants, polymorphisms associated with microRNA processing and adhesion molecules: the Normative Aging Study. Environ Health. 2011 May 21;10:45. doi: 10.1186/1476-069X-10-45.
49 Effect of quercetin and its metabolite on caveolin-1 expression induced by oxidized LDL and lysophosphatidylcholine in endothelial cells. J Clin Biochem Nutr. 2016 May;58(3):193-201. doi: 10.3164/jcbn.16-2. Epub 2016 Apr 16.
50 Epigenetic determinants of resistance to etoposide regulation of Bcl-X(L) and Bax by tumor microenvironmental factors. J Natl Cancer Inst. 2000 Jan 5;92(1):18-23. doi: 10.1093/jnci/92.1.18.
51 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.