Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYQT0ZI)

• DOT Name: Galectin-3 (LGALS3)
• Synonyms: Gal-3; 35 kDa lectin; Carbohydrate-binding protein 35; CBP 35; Galactose-specific lectin 3; Galactoside-binding protein; GALBP; IgE-binding protein; L-31; Laminin-binding protein; Lectin L-29; Mac-2 antigen
• Gene Name: LGALS3
• UniProt ID: LEG3_HUMAN
• PDB ID: 1A3K ; 1KJL ; 1KJR ; 2NMN ; 2NMO ; 2NN8 ; 2XG3 ; 3AYA ; 3AYC ; 3AYD ; 3AYE ; 3T1L ; 3T1M ; 3ZSJ ; 3ZSK ; 3ZSL ; 3ZSM ; 4BLI ; 4BLJ ; 4BM8 ; 4JC1 ; 4JCK ; 4LBJ ; 4LBK ; 4LBL ; 4LBM ; 4LBN ; 4LBO ; 4R9A ; 4R9B ; 4R9C ; 4R9D ; 4RL7 ; 4XBN ; 5E88 ; 5E89 ; 5E8A ; 5EXO ; 5H9P ; 5H9R ; 5IUQ ; 5NF7 ; 5NF9 ; 5NFA ; 5NFB ; 5NFC ; 5OAX ; 5ODY ; 6B8K ; 6EOG ; 6EOL ; 6EXY ; 6EYM ; 6F2Q ; 6F6Y ; 6FK2 ; 6FOF ; 6G0V ; 6H64 ; 6I74 ; 6I75 ; 6I76 ; 6I77 ; 6I78 ; 6KXA ; 6KXB ; 6Q0Q ; 6Q17 ; 6QGE ; 6QGF ; 6QLN ; 6QLO ; 6QLP ; 6QLQ ; 6QLR ; 6QLS ; 6QLT ; 6QLU ; 6RHL ; 6RHM ; 6RZF ; 6RZG ; 6RZH ; 6RZI ; 6RZJ ; 6RZK ; 6RZL ; 6RZM ; 6TF6 ; 6TF7 ; 6Y4C ; 6Y78 ; 6ZVF ; 7BE3 ; 7CXA ; 7DF5 ; 7RDO ; 7RDP ; 7RGX ; 7RGY ; 7RGZ ; 7RH0 ; 7RH1 ; 7RH3 ; 7RH4 ; 7XFA ; 7ZQX ; 8BZ3 ; 8OJI ; 8OJK ; 8OJM ; 8OJO ; 8PBF ; 8PF9 ; 8PFF ; 8PPN
• Pfam ID: PF00337
• Sequence:
  MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
  GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
  PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
  WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
  DLTSASYTMI
• Function: Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes.
• Tissue Specificity: A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes.
• Reactome Pathway:
  Advanced glycosylation endproduct receptor signaling (R-HSA-879415)
  RUNX1 regulates transcription of genes involved in differentiation of myeloid cells (R-HSA-8939246)
  RUNX2 regulates genes involved in differentiation of myeloid cells (R-HSA-8941333)
  Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Galectin-3 (LGALS3) decreases the response to substance of Fluorouracil.	[24]
Etoposide	DMNH3PG	Approved	Galectin-3 (LGALS3) affects the response to substance of Etoposide.	[25]
Mitomycin	DMH0ZJE	Approved	Galectin-3 (LGALS3) affects the response to substance of Mitomycin.	[25]
LY294002	DMY1AFS	Phase 1	Galectin-3 (LGALS3) decreases the response to substance of LY294002.	[26]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Galectin-3 (LGALS3).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Galectin-3 (LGALS3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Galectin-3 (LGALS3).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Galectin-3 (LGALS3).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Galectin-3 (LGALS3).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Galectin-3 (LGALS3).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Galectin-3 (LGALS3).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Galectin-3 (LGALS3).	[8]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Galectin-3 (LGALS3).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Galectin-3 (LGALS3).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Galectin-3 (LGALS3).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Galectin-3 (LGALS3).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Galectin-3 (LGALS3).	[12]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Galectin-3 (LGALS3).	[13]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Galectin-3 (LGALS3).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Galectin-3 (LGALS3).	[15]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Galectin-3 (LGALS3).	[12]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Galectin-3 (LGALS3).	[16]
Methimazole	DM25FL8	Approved	Methimazole increases the expression of Galectin-3 (LGALS3).	[17]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Galectin-3 (LGALS3).	[12]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Galectin-3 (LGALS3).	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Galectin-3 (LGALS3).	[20]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Galectin-3 (LGALS3).	[21]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Galectin-3 (LGALS3).	[22]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Galectin-3 (LGALS3).	[23]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Galectin-3 (LGALS3).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Galectin-3 (LGALS3).	[18]

References

• [1] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [12] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [13] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [14] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [15] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [16] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [17] Blood cell oxidative stress precedes hemolysis in whole blood-liver slice co-cultures of rat, dog, and human tissues. Toxicol Appl Pharmacol. 2010 May 1;244(3):354-65. doi: 10.1016/j.taap.2010.01.017. Epub 2010 Feb 6.
• [18] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [19] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [20] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [21] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [22] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [23] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [24] Galectin-3 germline variant at position 191 enhances nuclear accumulation and activation of -catenin in gastric cancer. Clin Exp Metastasis. 2011 Dec;28(8):743-50. doi: 10.1007/s10585-011-9406-8. Epub 2011 Jul 13.
• [25] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [26] Increased galectin-3 facilitates leukemia cell survival from apoptotic stimuli. Biochem Biophys Res Commun. 2011 Aug 26;412(2):334-40. doi: 10.1016/j.bbrc.2011.07.099. Epub 2011 Jul 29.