Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0FGQK7)

• DOT Name: Glioma pathogenesis-related protein 1 (GLIPR1)
• Synonyms: GliPR 1; Protein RTVP-1
• Gene Name: GLIPR1
• UniProt ID: GLIP1_HUMAN
• PDB ID: 3Q2R; 3Q2U
• Pfam ID: PF00188
• Sequence:
  MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTW
  DPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDE
  IQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGN
  YPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV
  NSVILILSVIITILVQHKYPNLVLLD
• Tissue Specificity: According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-glial-derived nervous system tumor cell lines. Also found in fetal kidney. According to PubMed:7607567 it is expressed only in brain tumor glioblastoma multiforme/astrocytoma and not in other nervous system tumors or normal fetal or adult tissues.
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Glioma pathogenesis-related protein 1 (GLIPR1).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Glioma pathogenesis-related protein 1 (GLIPR1).	[7]
Decitabine	DMQL8XJ	Approved	Decitabine affects the methylation of Glioma pathogenesis-related protein 1 (GLIPR1).	[12]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Glioma pathogenesis-related protein 1 (GLIPR1).	[26]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[11]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[13]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[14]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[15]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[16]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[17]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[18]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[19]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[20]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[11]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[22]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[23]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[24]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[25]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[16]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Glioma pathogenesis-related protein 1 (GLIPR1).	[27]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [11] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [12] Hypomethylation and aberrant expression of the glioma pathogenesis-related 1 gene in Wilms tumors. Neoplasia. 2007 Nov;9(11):970-8. doi: 10.1593/neo.07661.
• [13] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [14] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [15] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [16] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [17] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [18] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [19] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [20] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [21] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [22] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [23] BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
• [24] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [25] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [26] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [27] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.