Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT17D55D)

• DOT Name: Borealin (CDCA8)
• Synonyms: Cell division cycle-associated protein 8; Dasra-B; hDasra-B; Pluripotent embryonic stem cell-related gene 3 protein
• Gene Name: CDCA8
• UniProt ID: BOREA_HUMAN
• PDB ID: 2KDD; 2QFA; 2RAW; 2RAX; 6YIE; 6YIF; 6YIH; 7U5V
• Pfam ID: PF10512 ; PF10444
• Sequence:
  MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILR
  LPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVD
  EMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVS
  MVKPTPGLTPRFDSRVFKTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLR
  LLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
• Function: Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment.
• Reactome Pathway:
  Separation of Sister Chromatids (R-HSA-2467813)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  SUMOylation of DNA replication proteins (R-HSA-4615885)
  RHO GTPases Activate Formins (R-HSA-5663220)
  Mitotic Prometaphase (R-HSA-68877)
  EML4 and NUDC in mitotic spindle formation (R-HSA-9648025)
  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal (R-HSA-141444)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	Borealin (CDCA8) affects the response to substance of Vinblastine.	[29]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Borealin (CDCA8).	[1]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Borealin (CDCA8).	[25]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Borealin (CDCA8).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Borealin (CDCA8).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Borealin (CDCA8).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Borealin (CDCA8).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Borealin (CDCA8).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Borealin (CDCA8).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Borealin (CDCA8).	[8]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Borealin (CDCA8).	[8]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Borealin (CDCA8).	[9]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Borealin (CDCA8).	[10]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Borealin (CDCA8).	[11]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Borealin (CDCA8).	[12]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Borealin (CDCA8).	[13]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Borealin (CDCA8).	[14]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Borealin (CDCA8).	[12]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Borealin (CDCA8).	[15]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Borealin (CDCA8).	[16]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Borealin (CDCA8).	[17]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Borealin (CDCA8).	[18]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Borealin (CDCA8).	[12]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Borealin (CDCA8).	[19]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Borealin (CDCA8).	[7]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Borealin (CDCA8).	[20]
MGCD-0103	DM726HX	Phase 2	MGCD-0103 decreases the expression of Borealin (CDCA8).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Borealin (CDCA8).	[22]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Borealin (CDCA8).	[23]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Borealin (CDCA8).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Borealin (CDCA8).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Borealin (CDCA8).	[27]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Borealin (CDCA8).	[7]
Choline	DM5D9YK	Investigative	Choline affects the expression of Borealin (CDCA8).	[28]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [8] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [9] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [10] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [11] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [12] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [13] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [14] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [15] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [16] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [17] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [18] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [19] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [20] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [21] Induction of USP17 by combining BET and HDAC inhibitors in breast cancer cells. Oncotarget. 2015 Oct 20;6(32):33623-35. doi: 10.18632/oncotarget.5601.
• [22] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [23] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [24] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [25] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Gene expression analysis of human endometrial endothelial cells exposed to Bisphenol A. Reprod Toxicol. 2009 Jul;28(1):18-25. doi: 10.1016/j.reprotox.2009.03.006. Epub 2009 Mar 25.
• [28] Lymphocyte gene expression in subjects fed a low-choline diet differs between those who develop organ dysfunction and those who do not. Am J Clin Nutr. 2007 Jul;86(1):230-9. doi: 10.1093/ajcn/86.1.230.
• [29] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.