Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2J7JPD)

• DOT Name: Aquaporin-3 (AQP3)
• Synonyms: AQP-3; Aquaglyceroporin-3
• Gene Name: AQP3
• UniProt ID: AQP3_HUMAN
• Pfam ID: PF00230
• Sequence:
  MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN
  LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF
  GLYYDAIWHFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVD
  PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQ
  HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
• Function: Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism.
• Tissue Specificity: Widely expressed in epithelial cells of kidney (collecting ducts) and airways, in keratinocytes, immature dendritic cells and erythrocytes. Isoform 2 is not detectable in erythrocytes at the protein level.
• KEGG Pathway: Vasopressin-regulated water reabsorption (hsa04962)
• Reactome Pathway:
  Passive transport by Aquaporins (R-HSA-432047)
  Vasopressin regulates renal water homeostasis via Aquaporins (R-HSA-432040)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Aquaporin-3 (AQP3) affects the response to substance of Arsenic.	[35]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Aquaporin-3 (AQP3).	[1]

42 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Aquaporin-3 (AQP3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Aquaporin-3 (AQP3).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Aquaporin-3 (AQP3).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Aquaporin-3 (AQP3).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Aquaporin-3 (AQP3).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Aquaporin-3 (AQP3).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Aquaporin-3 (AQP3).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Aquaporin-3 (AQP3).	[9]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Aquaporin-3 (AQP3).	[10]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Aquaporin-3 (AQP3).	[11]
Selenium	DM25CGV	Approved	Selenium increases the expression of Aquaporin-3 (AQP3).	[12]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Aquaporin-3 (AQP3).	[13]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Aquaporin-3 (AQP3).	[14]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Aquaporin-3 (AQP3).	[15]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Aquaporin-3 (AQP3).	[16]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Aquaporin-3 (AQP3).	[17]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Aquaporin-3 (AQP3).	[18]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Aquaporin-3 (AQP3).	[19]
Ampicillin	DMHWE7P	Approved	Ampicillin decreases the expression of Aquaporin-3 (AQP3).	[8]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Aquaporin-3 (AQP3).	[20]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Aquaporin-3 (AQP3).	[21]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Aquaporin-3 (AQP3).	[21]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Aquaporin-3 (AQP3).	[22]
Guaiacol	DMN4E7T	Phase 3	Guaiacol increases the expression of Aquaporin-3 (AQP3).	[21]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Aquaporin-3 (AQP3).	[21]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Aquaporin-3 (AQP3).	[12]
Puerarin	DMJIMXH	Phase 2	Puerarin increases the expression of Aquaporin-3 (AQP3).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Aquaporin-3 (AQP3).	[23]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Aquaporin-3 (AQP3).	[24]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Aquaporin-3 (AQP3).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Aquaporin-3 (AQP3).	[26]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Aquaporin-3 (AQP3).	[27]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Aquaporin-3 (AQP3).	[28]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Aquaporin-3 (AQP3).	[29]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Aquaporin-3 (AQP3).	[30]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Aquaporin-3 (AQP3).	[31]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Aquaporin-3 (AQP3).	[8]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Aquaporin-3 (AQP3).	[17]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid decreases the expression of Aquaporin-3 (AQP3).	[32]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid increases the expression of Aquaporin-3 (AQP3).	[21]
[3H]cAMP	DMZRQU7	Investigative	[3H]cAMP increases the expression of Aquaporin-3 (AQP3).	[33]
Serotonin	DMOFCRY	Investigative	Serotonin increases the expression of Aquaporin-3 (AQP3).	[34]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] In vitro study of transporters involved in intestinal absorption of inorganic arsenic. Chem Res Toxicol. 2012 Feb 20;25(2):446-53. doi: 10.1021/tx200491f. Epub 2012 Jan 26.
• [10] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [11] Peripheral blood expression of nuclear factor-kappab-regulated genes is associated with rheumatoid arthritis disease activity and responds differentially to anti-tumor necrosis factor-alpha versus methotrexate. J Rheumatol. 2007 Sep;34(9):1817-22. Epub 2007 Aug 1.
• [12] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [13] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [14] Induction of aquaporin 3 by corticosteroid in a human airway epithelial cell line. Am J Physiol. 1997 Nov;273(5):L1090-5. doi: 10.1152/ajplung.1997.273.5.L1090.
• [15] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [16] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [17] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [18] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [19] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [20] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [21] Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
• [22] Curcumin attenuates EGF-induced AQP3 up-regulation and cell migration in human ovarian cancer cells. Cancer Chemother Pharmacol. 2008 Oct;62(5):857-65. doi: 10.1007/s00280-007-0674-6. Epub 2008 Jan 23.
• [23] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [24] MCM5 as a target of BET inhibitors in thyroid cancer cells. Endocr Relat Cancer. 2016 Apr;23(4):335-47. doi: 10.1530/ERC-15-0322. Epub 2016 Feb 24.
• [25] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [26] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [27] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [28] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [29] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [30] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [31] Expression of aquaporin-3 in human peritoneal mesothelial cells and its up-regulation by glucose in vitro. Kidney Int. 2002 Oct;62(4):1431-9. doi: 10.1111/j.1523-1755.2002.kid564.x.
• [32] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [33] Enhancement of aquaporin-3 by vasoactive intestinal polypeptide in a human colonic epithelial cell line. J Gastroenterol Hepatol. 2003 Feb;18(2):203-10. doi: 10.1046/j.1440-1746.2003.02949.x.
• [34] Morphine-Induced Constipation Develops With Increased Aquaporin-3 Expression in the Colon via Increased Serotonin Secretion. Toxicol Sci. 2015 Jun;145(2):337-47. doi: 10.1093/toxsci/kfv055. Epub 2015 Mar 12.
• [35] A case-control study of polymorphisms in xenobiotic and arsenic metabolism genes and arsenic-related bladder cancer in New Hampshire. Toxicol Lett. 2012 Apr 5;210(1):100-6. doi: 10.1016/j.toxlet.2012.01.015. Epub 2012 Jan 28.