Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3FHZ81)

• DOT Name: Interleukin-32 (IL32)
• Synonyms: IL-32; Natural killer cells protein 4; Tumor necrosis factor alpha-inducing factor
• Gene Name: IL32
• UniProt ID: IL32_HUMAN
• Pfam ID: PF15225
• Sequence:
  MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC
  LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE
  KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
  VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
• Function: Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
• Tissue Specificity: Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells.
• KEGG Pathway: Cytokine-cytokine receptor interaction (hsa04060)
• Reactome Pathway:
  RAC3 GTPase cycle (R-HSA-9013423)
  Other interleukin signaling (R-HSA-449836)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Interleukin-32 (IL32).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Interleukin-32 (IL32).	[7]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Interleukin-32 (IL32).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Interleukin-32 (IL32).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interleukin-32 (IL32).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Interleukin-32 (IL32).	[5]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Interleukin-32 (IL32).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Interleukin-32 (IL32).	[8]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Interleukin-32 (IL32).	[9]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Interleukin-32 (IL32).	[9]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Interleukin-32 (IL32).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Interleukin-32 (IL32).	[5]
Marinol	DM70IK5	Approved	Marinol increases the expression of Interleukin-32 (IL32).	[11]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Interleukin-32 (IL32).	[12]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Interleukin-32 (IL32).	[13]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Interleukin-32 (IL32).	[14]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of Interleukin-32 (IL32).	[15]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Interleukin-32 (IL32).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Interleukin-32 (IL32).	[8]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interleukin-32 (IL32).	[17]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Interleukin-32 (IL32).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Interleukin-32 (IL32).	[19]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Interleukin-32 (IL32).	[20]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Interleukin-32 (IL32).	[21]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Interleukin-32 (IL32).	[22]
CATECHIN	DMY38SB	Investigative	CATECHIN decreases the expression of Interleukin-32 (IL32).	[23]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [6] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [7] Transcriptomics and methylomics of CD4-positive T cells in arsenic-exposed women. Arch Toxicol. 2017 May;91(5):2067-2078. doi: 10.1007/s00204-016-1879-4. Epub 2016 Nov 12.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [10] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [11] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [12] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [13] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [14] 2,3,7,8-tetrachlorodibenzo-p-dioxin augments the modulation of gene expression mediated by the thyroid hormone receptor. Toxicol Appl Pharmacol. 2004 Feb 1;194(3):201-10. doi: 10.1016/j.taap.2003.09.010.
• [15] Transcriptional profiling suggests that Nevirapine and Ritonavir cause drug induced liver injury through distinct mechanisms in primary human hepatocytes. Chem Biol Interact. 2016 Aug 5;255:31-44.
• [16] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [17] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [18] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [19] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [20] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [21] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [22] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [23] Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.