Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3I9VO9)

DOT Name SUN domain-containing ossification factor (SUCO)
Synonyms Membrane protein CH1; Protein osteopotentia homolog; SUN-like protein 1
Gene Name SUCO
Related Disease
Cardiac failure ( )
Congestive heart failure ( )
Epilepsy ( )
Hepatocellular carcinoma ( )
Psoriasis ( )
Schizophrenia ( )
Osteogenesis imperfecta ( )
Osteogenesis imperfecta type 5 ( )
Kennedy disease ( )
Neoplasm ( )
Schistosomiasis ( )
Temporal lobe epilepsy ( )
UniProt ID
SUCO_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07738
Sequence
MKKHRRALALVSCLFLCSLVWLPSWRVCCKESSSASASSYYSQDDNCALENEDVQFQKKD
EREGPINAESLGKSGSNLPISPKEHKLKDDSIVDVQNTESKKLSPPVVETLPTVDLHEES
SNAVVDSETVENISSSSTSEITPISKLDEIEKSGTIPIAKPSETEQSETDCDVGEALDAS
APIEQPSFVSPPDSLVGQHIENVSSSHGKGKITKSEFESKVSASEQGGGDPKSALNASDN
LKNESSDYTKPGDIDPTSVASPKDPEDIPTFDEWKKKVMEVEKEKSQSMHASSNGGSHAT
KKVQKNRNNYASVECGAKILAANPEAKSTSAILIENMDLYMLNPCSTKIWFVIELCEPIQ
VKQLDIANYELFSSTPKDFLVSISDRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYV
KMFIKYIKVELLSHFGSEHFCPLSLIRVFGTSMVEEYEEIADSQYHSERQELFDEDYDYP
LDYNTGEDKSSKNLLGSATNAILNMVNIAANILGAKTEDLTEGNKSISENATATAAPKMP
ESTPVSTPVPSPEYVTTEVHTHDMEPSTPDTPKESPIVQLVQEEEEEASPSTVTLLGSGE
QEDESSPWFESETQIFCSELTTICCISSFSEYIYKWCSVRVALYRQRSRTALSKGKDYLV
LAQPPLLLPAESVDVSVLQPLSGELENTNIEREAETVVLGDLSSSMHQDDLVNHTVDAVE
LEPSHSQTLSQSLLLDITPEINPLPKIEVSESVEYEAGHIPSPVIPQESSVEIDNETEQK
SESFSSIEKPSITYETNKVNELMDNIIKEDVNSMQIFTKLSETIVPPINTATVPDNEDGE
AKMNIADTAKQTLISVVDSSSLPEVKEEEQSPEDALLRGLQRTATDFYAELQNSTDLGYA
NGNLVHGSNQKESVFMRLNNRIKALEVNMSLSGRYLEELSQRYRKQMEEMQKAFNKTIVK
LQNTSRIAEEQDQRQTEAIQLLQAQLTNMTQLVSNLSATVAELKREVSDRQSYLVISLVL
CVVLGLMLCMQRCRNTSQFDGDYISKLPKSNQYPSPKRCFSSYDDMNLKRRTSFPLMRSK
SLQLTGKEVDPNDLYIVEPLKFSPEKKKKRCKYKIEKIETIKPEEPLHPIANGDIKGRKP
FTNQRDFSNMGEVYHSSYKGPPSEGSSETSSQSEESYFCGISACTSLCNGQSQKTKTEKR
ALKRRRSKVQDQGKLIKTLIQTKSGSLPSLHDIIKGNKEITVGTFGVTAVSGHI
Function Required for bone modeling during late embryogenesis. Regulates type I collagen synthesis in osteoblasts during their postnatal maturation.
Tissue Specificity Highly expressed in pancreas and testis and to a lower extent in prostate, ovary, heart, thymus, small intestine and spleen.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiac failure DISDC067 Strong Genetic Variation [1]
Congestive heart failure DIS32MEA Strong Genetic Variation [1]
Epilepsy DISBB28L Strong Biomarker [2]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [3]
Psoriasis DIS59VMN Strong Biomarker [4]
Schizophrenia DISSRV2N Strong Biomarker [5]
Osteogenesis imperfecta DIS7XQSD moderate Biomarker [6]
Osteogenesis imperfecta type 5 DISXSBGZ moderate Biomarker [6]
Kennedy disease DISXZVM1 Limited Altered Expression [7]
Neoplasm DISZKGEW Limited Biomarker [8]
Schistosomiasis DIS6PD44 Limited Biomarker [9]
Temporal lobe epilepsy DISNOPXX Limited Autosomal dominant [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of SUN domain-containing ossification factor (SUCO). [11]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of SUN domain-containing ossification factor (SUCO). [20]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of SUN domain-containing ossification factor (SUCO). [12]
Tretinoin DM49DUI Approved Tretinoin increases the expression of SUN domain-containing ossification factor (SUCO). [13]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of SUN domain-containing ossification factor (SUCO). [14]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of SUN domain-containing ossification factor (SUCO). [15]
Estradiol DMUNTE3 Approved Estradiol increases the expression of SUN domain-containing ossification factor (SUCO). [16]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of SUN domain-containing ossification factor (SUCO). [17]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of SUN domain-containing ossification factor (SUCO). [18]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of SUN domain-containing ossification factor (SUCO). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Optimising pacemaker therapy and medical therapy in pacemaker patients for heart failure: protocol for the OPT-PACE randomised controlled trial.BMJ Open. 2019 Jul 17;9(7):e028613. doi: 10.1136/bmjopen-2018-028613.
2 Exome sequencing identifies SUCO mutations in mesial temporal lobe epilepsy.Neurosci Lett. 2015 Mar 30;591:149-154. doi: 10.1016/j.neulet.2015.02.009. Epub 2015 Feb 7.
3 SUCO as a Promising Diagnostic Biomarker of Hepatocellular Carcinoma: Integrated Analysis and Experimental Validation.Med Sci Monit. 2019 Aug 22;25:6292-6303. doi: 10.12659/MSM.915262.
4 Early clinical response to tofacitinib treatment as a predictor of subsequent efficacy: Results from two phase 3 studies of patients with moderate-to-severe plaque psoriasis.J Dermatolog Treat. 2017 Feb;28(1):3-7. doi: 10.1080/09546634.2016.1214671. Epub 2016 Aug 18.
5 Association of alpha4beta2 nicotinic receptor and heavy smoking in schizophrenia.J Psychiatry Neurosci. 2007 Nov;32(6):412-6.
6 Osteopotentia regulates osteoblast maturation, bone formation, and skeletal integrity in mice.J Cell Biol. 2010 May 3;189(3):511-25. doi: 10.1083/jcb.201003006.
7 CD24 cell surface expression in Mvt1 mammary cancer cells serves as a biomarker for sensitivity to anti-IGF1R therapy.Breast Cancer Res. 2016 May 14;18(1):51. doi: 10.1186/s13058-016-0711-7.
8 A self-inactivating lentiviral vector for SCID-X1 gene therapy that does not activate LMO2 expression in human T cells.Blood. 2010 Aug 12;116(6):900-8. doi: 10.1182/blood-2009-10-250209. Epub 2010 May 10.
9 Saposin-like proteins are expressed in the gastrodermis of Schistosoma mansoni and are immunogenic in natural infections.Int J Infect Dis. 2008 Nov;12(6):e39-47. doi: 10.1016/j.ijid.2007.10.007. Epub 2008 Jun 20.
10 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
11 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
12 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
13 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
14 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
15 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
16 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
17 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
18 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
19 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
20 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.