Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4TZH3J)

DOT Name Complement C1q-like protein 3 (C1QL3)
Synonyms C1q and tumor necrosis factor-related protein 13; C1q/TNF-related protein 13
Gene Name C1QL3
Related Disease
Advanced cancer ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Breast cancer ( )
Breast carcinoma ( )
Cholangiocarcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Non-insulin dependent diabetes ( )
Polycystic ovarian syndrome ( )
Type-1/2 diabetes ( )
Vascular disease ( )
Non-alcoholic fatty liver disease ( )
Chronic renal failure ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Obesity ( )
UniProt ID
C1QL3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00386 ; PF01391
Sequence
MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQ
GPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAAT
YSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMR
GGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGN
NNKYSTFSGFIIYAD
Function
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC1 and PCK1 and hence decreases de novo glucose production.
Tissue Specificity Highly expressed in adipose tissue, with expression levels at least 2 orders of magnitude higher than in other tissues, including brain and kidney.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Arteriosclerosis DISK5QGC Strong Biomarker [2]
Atherosclerosis DISMN9J3 Strong Biomarker [2]
Breast cancer DIS7DPX1 Strong Biomarker [1]
Breast carcinoma DIS2UE88 Strong Biomarker [1]
Cholangiocarcinoma DIS71F6X Strong Genetic Variation [1]
Colon cancer DISVC52G Strong Biomarker [1]
Colon carcinoma DISJYKUO Strong Biomarker [1]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [3]
Polycystic ovarian syndrome DISZ2BNG Strong Biomarker [4]
Type-1/2 diabetes DISIUHAP Strong Biomarker [2]
Vascular disease DISVS67S Strong Biomarker [2]
Non-alcoholic fatty liver disease DISDG1NL moderate Altered Expression [5]
Chronic renal failure DISGG7K6 Limited Altered Expression [6]
Coronary atherosclerosis DISKNDYU Limited Altered Expression [7]
Coronary heart disease DIS5OIP1 Limited Altered Expression [7]
Obesity DIS47Y1K Limited Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Complement C1q-like protein 3 (C1QL3). [8]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Complement C1q-like protein 3 (C1QL3). [9]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Complement C1q-like protein 3 (C1QL3). [10]
------------------------------------------------------------------------------------

References

1 Anticancer activity of synthetic ()-kusunokinin and its derivative ()-bursehernin on human cancer cell lines.Biomed Pharmacother. 2019 Sep;117:109115. doi: 10.1016/j.biopha.2019.109115. Epub 2019 Jun 17.
2 CTRP13 Preserves Endothelial Function by Targeting GTP Cyclohydrolase 1 in Diabetes.Diabetes. 2020 Jan;69(1):99-111. doi: 10.2337/db19-0635. Epub 2019 Nov 1.
3 A gene expression network analysis of the pancreatic islets from lean and obese mice identifies complement 1qlike-3 secreted protein as a regulator of -cell function.Sci Rep. 2019 Jul 12;9(1):10119. doi: 10.1038/s41598-019-46219-3.
4 Lower circulating levels of CTRP12 and CTRP13 in polycystic ovarian syndrome: Irrespective of obesity.PLoS One. 2018 Dec 12;13(12):e0208059. doi: 10.1371/journal.pone.0208059. eCollection 2018.
5 Association of CTRP13 With Liver Enzymes and Cognitive Symptoms in Nonalcoholic Fatty Liver Disease.Nurs Res. 2019 Jan/Feb;68(1):29-38. doi: 10.1097/NNR.0000000000000319.
6 CTRP13 attenuates vascular calcification by regulating Runx2.FASEB J. 2019 Aug;33(8):9627-9637. doi: 10.1096/fj.201900293RRR. Epub 2019 May 30.
7 CTRP13 inhibits atherosclerosis via autophagy-lysosome-dependent degradation of CD36.FASEB J. 2019 Feb;33(2):2290-2300. doi: 10.1096/fj.201801267RR. Epub 2018 Sep 17.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.