Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT54LLZJ)

DOT Name Persephin (PSPN)
Synonyms PSP
Gene Name PSPN
Related Disease
Attention deficit hyperactivity disorder ( )
Cerebral infarction ( )
Neoplasm ( )
Schizophrenia ( )
Wolfram syndrome ( )
Advanced cancer ( )
Autonomic nervous system disorder ( )
Corticobasal degeneration ( )
Dementia ( )
Depression ( )
Dysautonomia ( )
Familial spontaneous pneumothorax ( )
Frontotemporal dementia ( )
Hirschsprung disease ( )
Inflammatory bowel disease ( )
Late-onset Parkinson disease ( )
Matthew-Wood syndrome ( )
Myotonic dystrophy ( )
Parkinson disease ( )
Pick disease ( )
Pneumothorax ( )
Postencephalitic Parkinson disease ( )
Primary progressive aphasia ( )
Progressive supranuclear palsy ( )
Prostate adenocarcinoma ( )
Sjogren syndrome ( )
Tauopathy ( )
Type-1/2 diabetes ( )
Encephalitis ( )
Anxiety ( )
Anxiety disorder ( )
Lewy body dementia ( )
Nervous system disease ( )
Nutritional disorder ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
PSPN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00019
Sequence
MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRR
ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHG
GPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
Function Exhibits neurotrophic activity on mesencephalic dopaminergic and motor neurons.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
PI3K-Akt sig.ling pathway (hsa04151 )
Reactome Pathway
RAF/MAP kinase cascade (R-HSA-5673001 )
RET signaling (R-HSA-8853659 )
NCAM1 interactions (R-HSA-419037 )

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Attention deficit hyperactivity disorder DISL8MX9 Definitive Biomarker [1]
Cerebral infarction DISR1WNP Definitive Biomarker [2]
Neoplasm DISZKGEW Definitive Altered Expression [3]
Schizophrenia DISSRV2N Definitive Altered Expression [1]
Wolfram syndrome DISN16XW Definitive Altered Expression [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Autonomic nervous system disorder DIS6JLTA Strong Biomarker [6]
Corticobasal degeneration DISSMOTT Strong Biomarker [7]
Dementia DISXL1WY Strong Biomarker [8]
Depression DIS3XJ69 Strong Biomarker [9]
Dysautonomia DISF4MT6 Strong Biomarker [6]
Familial spontaneous pneumothorax DISNM7SU Strong Biomarker [10]
Frontotemporal dementia DISKYHXL Strong Biomarker [11]
Hirschsprung disease DISUUSM1 Strong Genetic Variation [12]
Inflammatory bowel disease DISGN23E Strong Biomarker [13]
Late-onset Parkinson disease DIS9IOUI Strong Biomarker [14]
Matthew-Wood syndrome DISA7HR7 Strong Genetic Variation [3]
Myotonic dystrophy DISNBEMX Strong Biomarker [6]
Parkinson disease DISQVHKL Strong Genetic Variation [15]
Pick disease DISP6X50 Strong Genetic Variation [16]
Pneumothorax DISP86H1 Strong Genetic Variation [17]
Postencephalitic Parkinson disease DIS1TYXP Strong Biomarker [8]
Primary progressive aphasia DISLRYFE Strong Biomarker [18]
Progressive supranuclear palsy DISO5KRQ Strong Biomarker [19]
Prostate adenocarcinoma DISBZYU8 Strong Genetic Variation [20]
Sjogren syndrome DISUBX7H Strong Biomarker [21]
Tauopathy DISY2IPA Strong Genetic Variation [16]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [4]
Encephalitis DISLD1RL moderate Altered Expression [22]
Anxiety DISIJDBA Disputed Biomarker [23]
Anxiety disorder DISBI2BT Disputed Biomarker [23]
Lewy body dementia DISAE66J Limited Biomarker [24]
Nervous system disease DISJ7GGT Limited Biomarker [19]
Nutritional disorder DIS0W6QK Limited Biomarker [25]
Prostate cancer DISF190Y Limited Biomarker [26]
Prostate carcinoma DISMJPLE Limited Biomarker [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 36 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Persephin (PSPN). [27]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Persephin (PSPN). [31]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Persephin (PSPN). [28]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of Persephin (PSPN). [29]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Persephin (PSPN). [30]
------------------------------------------------------------------------------------

References

1 Cognitive and behavioral precursors of schizophrenia.Dev Psychopathol. 1999 Summer;11(3):487-508. doi: 10.1017/s0954579499002175.
2 Effects of cerebral ischemia in mice deficient in Persephin.Proc Natl Acad Sci U S A. 2002 Jul 9;99(14):9521-6. doi: 10.1073/pnas.152535899. Epub 2002 Jul 1.
3 Human pancreatic cancer contains a side population expressing cancer stem cell-associated and prognostic genes.PLoS One. 2013 Sep 17;8(9):e73968. doi: 10.1371/journal.pone.0073968. eCollection 2013.
4 Pancreatic stone protein/regenerating protein is a potential biomarker for endoplasmic reticulum stress in beta cells.Sci Rep. 2019 Mar 26;9(1):5199. doi: 10.1038/s41598-019-41604-4.
5 Analyzing the capability of PSP, PCT and sCD25 to support the diagnosis of infection in cancer patients with febrile neutropenia.Clin Chem Lab Med. 2019 Mar 26;57(4):540-548. doi: 10.1515/cclm-2018-0154.
6 Coexistence of Progressive Supranuclear Palsy With Pontocerebellar Atrophy and Myotonic Dystrophy Type 1.J Neuropathol Exp Neurol. 2019 Aug 1;78(8):756-762. doi: 10.1093/jnen/nlz048.
7 Side effects induced by the acute levodopa challenge in Parkinson's Disease and atypical parkinsonisms.PLoS One. 2017 Feb 16;12(2):e0172145. doi: 10.1371/journal.pone.0172145. eCollection 2017.
8 Parkinson's syndrome associated with neurofibrillary degeneration and tau pathologic findings.Mov Disord. 2003 Sep;18 Suppl 6:S28-33. doi: 10.1002/mds.10560.
9 Self-Reported Graphic Personal and Social Performance Scale (SRG-PSP) for measuring functionality in patients with bipolar disorder.J Affect Disord. 2017 Jun;215:256-262. doi: 10.1016/j.jad.2017.02.018. Epub 2017 Feb 20.
10 A novel dual-covering method in video-assisted thoracic surgery for pediatric primary spontaneous pneumothorax.Surg Today. 2019 Jul;49(7):587-592. doi: 10.1007/s00595-019-01785-x. Epub 2019 Apr 6.
11 Cerebellar atrophy in neurodegeneration-a meta-analysis.J Neurol Neurosurg Psychiatry. 2017 Sep;88(9):780-788. doi: 10.1136/jnnp-2017-315607. Epub 2017 May 13.
12 Novel mutations at RET ligand genes preventing receptor activation are associated to Hirschsprung's disease.J Mol Med (Berl). 2011 May;89(5):471-80. doi: 10.1007/s00109-010-0714-2. Epub 2011 Jan 5.
13 Genome-wide analysis identifies rare copy number variations associated with inflammatory bowel disease.PLoS One. 2019 Jun 11;14(6):e0217846. doi: 10.1371/journal.pone.0217846. eCollection 2019.
14 Manual MRI morphometry in Parkinsonian syndromes.Mov Disord. 2017 May;32(5):778-782. doi: 10.1002/mds.26921. Epub 2017 Feb 2.
15 The genetic and clinico-pathological profile of early-onset progressive supranuclear palsy.Mov Disord. 2019 Sep;34(9):1307-1314. doi: 10.1002/mds.27786. Epub 2019 Jul 12.
16 Involvement of Oligodendrocytes in Tau Seeding and Spreading in Tauopathies.Front Aging Neurosci. 2019 May 28;11:112. doi: 10.3389/fnagi.2019.00112. eCollection 2019.
17 Primary and Secondary Spontaneous Pneumothorax: Prevalence, Clinical Features, and In-Hospital Mortality.Can Respir J. 2017;2017:6014967. doi: 10.1155/2017/6014967. Epub 2017 Mar 13.
18 C9ORF72 repeat expansions in the frontotemporal dementias spectrum of diseases: a flow-chart for genetic testing.J Alzheimers Dis. 2013;34(2):485-99. doi: 10.3233/JAD-121456.
19 Sensitivity and Specificity of Diagnostic Criteria for Progressive Supranuclear Palsy.Mov Disord. 2019 Aug;34(8):1144-1153. doi: 10.1002/mds.27619. Epub 2019 Feb 6.
20 A novel knock-in prostate cancer model demonstrates biology similar to that of human prostate cancer and suitable for preclinical studies.Mol Ther. 2005 Mar;11(3):348-62. doi: 10.1016/j.ymthe.2004.12.005.
21 Novel Sjgren's autoantibodies found in fibromyalgia patients with sicca and/or xerostomia.Autoimmun Rev. 2019 Feb;18(2):199-202. doi: 10.1016/j.autrev.2018.09.004. Epub 2018 Dec 18.
22 Analysis of neurotrophic and antioxidant factors related to midbrain dopamine neuronal loss and brain inflammation in the cerebrospinal fluid of the elderly.Exp Gerontol. 2018 Sep;110:54-60. doi: 10.1016/j.exger.2018.05.009. Epub 2018 May 19.
23 Psychological factors predict an unfavorable pain trajectory after hysterectomy: a prospective cohort study on chronic postsurgical pain.Pain. 2018 May;159(5):956-967. doi: 10.1097/j.pain.0000000000001170.
24 Non-Alzheimer's disease dementias: anatomic, clinical, and molecular correlates.Can J Psychiatry. 2004 Mar;49(3):164-71. doi: 10.1177/070674370404900303.
25 Radiolucent and calcified pancreatic lithiasis: two different diseases. Role of alcohol and heredity.Scand J Gastroenterol. 1992;27(1):71-6. doi: 10.3109/00365529209011170.
26 Comparison of prostate-specific promoters and the use of PSP-driven virotherapy for prostate cancer.Biomed Res Int. 2013;2013:624632. doi: 10.1155/2013/624632. Epub 2013 Jan 31.
27 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
28 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
29 Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
30 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
31 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.