Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5887KR)

• DOT Name: Forkhead box protein M1 (FOXM1)
• Synonyms: Forkhead-related protein FKHL16; Hepatocyte nuclear factor 3 forkhead homolog 11; HFH-11; HNF-3/fork-head homolog 11; M-phase phosphoprotein 2; MPM-2 reactive phosphoprotein 2; Transcription factor Trident; Winged-helix factor from INS-1 cells
• Gene Name: FOXM1
• UniProt ID: FOXM1_HUMAN
• PDB ID: 3G73; 7FJ2
• Pfam ID: PF00250
• Sequence:
  MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
  GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
  LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
  LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
  YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
  ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
  LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
  PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
  SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
  RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
  PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
  TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
  GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
• Function: Transcription factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Also plays a role in DNA break repair, participating in the DNA damage checkpoint response. Promotes transcription of PHB2.
• Tissue Specificity: Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.
• KEGG Pathway: Cellular senescence (hsa04218)
• Reactome Pathway:
  Cyclin A/B1/B2 associated events during G2/M transition (R-HSA-69273)
  Polo-like kinase mediated events (R-HSA-156711)

Molecular Interaction Atlas (MIA) of This DOT

43 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Forkhead box protein M1 (FOXM1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Forkhead box protein M1 (FOXM1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Forkhead box protein M1 (FOXM1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Forkhead box protein M1 (FOXM1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Forkhead box protein M1 (FOXM1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Forkhead box protein M1 (FOXM1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Forkhead box protein M1 (FOXM1).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Forkhead box protein M1 (FOXM1).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Forkhead box protein M1 (FOXM1).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Forkhead box protein M1 (FOXM1).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Forkhead box protein M1 (FOXM1).	[11]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Forkhead box protein M1 (FOXM1).	[11]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Forkhead box protein M1 (FOXM1).	[12]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Forkhead box protein M1 (FOXM1).	[13]
Menadione	DMSJDTY	Approved	Menadione decreases the expression of Forkhead box protein M1 (FOXM1).	[10]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Forkhead box protein M1 (FOXM1).	[14]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Forkhead box protein M1 (FOXM1).	[15]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Forkhead box protein M1 (FOXM1).	[16]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Forkhead box protein M1 (FOXM1).	[17]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Forkhead box protein M1 (FOXM1).	[18]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Forkhead box protein M1 (FOXM1).	[19]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Forkhead box protein M1 (FOXM1).	[20]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Forkhead box protein M1 (FOXM1).	[21]
Imatinib	DM7RJXL	Approved	Imatinib decreases the expression of Forkhead box protein M1 (FOXM1).	[16]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Forkhead box protein M1 (FOXM1).	[22]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Forkhead box protein M1 (FOXM1).	[23]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Forkhead box protein M1 (FOXM1).	[24]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Forkhead box protein M1 (FOXM1).	[25]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Forkhead box protein M1 (FOXM1).	[26]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Forkhead box protein M1 (FOXM1).	[27]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Forkhead box protein M1 (FOXM1).	[29]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Forkhead box protein M1 (FOXM1).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Forkhead box protein M1 (FOXM1).	[31]
Harmine	DMPA5WD	Patented	Harmine increases the expression of Forkhead box protein M1 (FOXM1).	[32]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Forkhead box protein M1 (FOXM1).	[33]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Forkhead box protein M1 (FOXM1).	[22]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Forkhead box protein M1 (FOXM1).	[36]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Forkhead box protein M1 (FOXM1).	[37]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Forkhead box protein M1 (FOXM1).	[38]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Forkhead box protein M1 (FOXM1).	[39]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Forkhead box protein M1 (FOXM1).	[40]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Forkhead box protein M1 (FOXM1).	[41]
Citraconic acid	DMCIM9A	Investigative	Citraconic acid increases the expression of Forkhead box protein M1 (FOXM1).	[43]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Forkhead box protein M1 (FOXM1).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Forkhead box protein M1 (FOXM1).	[34]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Forkhead box protein M1 (FOXM1).	[35]
NSC-106970	DMHK0F6	Investigative	NSC-106970 affects the phosphorylation of Forkhead box protein M1 (FOXM1).	[42]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [10] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [11] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [12] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [13] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [14] New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
• [15] mTOR inhibition reverses acquired endocrine therapy resistance of breast cancer cells at the cell proliferation and gene-expression levels. Cancer Sci. 2008 Oct;99(10):1992-2003. doi: 10.1111/j.1349-7006.2008.00955.x.
• [16] Anthelmintic Niclosamide Disrupts the Interplay of p65 and FOXM1/-catenin and Eradicates Leukemia Stem Cells in Chronic Myelogenous Leukemia. Clin Cancer Res. 2017 Feb 1;23(3):789-803. doi: 10.1158/1078-0432.CCR-16-0226. Epub 2016 Aug 4.
• [17] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [18] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [19] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [20] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [21] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [22] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [23] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [24] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [25] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [26] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [27] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [28] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [29] Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
• [30] Natura-alpha targets forkhead box m1 and inhibits androgen-dependent and -independent prostate cancer growth and invasion. Clin Cancer Res. 2011 Jul 1;17(13):4414-24. doi: 10.1158/1078-0432.CCR-11-0431. Epub 2011 May 23.
• [31] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [32] A high-throughput chemical screen reveals that harmine-mediated inhibition of DYRK1A increases human pancreatic beta cell replication. Nat Med. 2015 Apr;21(4):383-8. doi: 10.1038/nm.3820. Epub 2015 Mar 9.
• [33] Proteasome inhibition creates a chromatin landscape favorable to RNA Pol II processivity. J Biol Chem. 2020 Jan 31;295(5):1271-1287. doi: 10.1074/jbc.RA119.011174. Epub 2019 Dec 5.
• [34] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [35] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [36] Changes in differential gene expression in fibroblast cells from patients with triple A syndrome under oxidative stress. Horm Metab Res. 2013 Feb;45(2):102-8.
• [37] Imbalance in the antioxidant defence system and pro-genotoxic status induced by high glucose concentrations: In vitro testing in human liver cells. Toxicol In Vitro. 2020 Dec;69:105001. doi: 10.1016/j.tiv.2020.105001. Epub 2020 Sep 15.
• [38] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [39] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [40] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [41] BET Bromodomain Inhibition as a Therapeutic Strategy in Ovarian Cancer by Downregulating FoxM1. Theranostics. 2016 Jan 1;6(2):219-30. doi: 10.7150/thno.13178. eCollection 2016.
• [42] 5,7,3'-Trihydroxy-3,4'-dimethoxyflavone inhibits the tubulin polymerization and activates the sphingomyelin pathway. Mol Carcinog. 2011 Feb;50(2):113-22. doi: 10.1002/mc.20693. Epub 2010 Dec 10.
• [43] Fumarate Mediates a Chronic Proliferative Signal in Fumarate Hydratase-Inactivated Cancer Cells by Increasing Transcription and Translation of Ferritin Genes. Mol Cell Biol. 2017 May 16;37(11):e00079-17. doi: 10.1128/MCB.00079-17. Print 2017 Jun 1.