Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5RG4J0)

• DOT Name: Protein FAM107B (FAM107B)
• Gene Name: FAM107B
• Related Disease:
  Abetalipoproteinemia
  Acute myocardial infarction
  Advanced cancer
  AIDS-related lymphoma
  Autism
  Hepatitis C virus infection
  Kaposi sarcoma
  Myotonic dystrophy
  Neoplasm
  Thyroid gland carcinoma
  Breast cancer
  Breast carcinoma
  Acute myelogenous leukaemia
  Gastric cancer
  Stomach cancer
  Thyroid cancer
• UniProt ID: F107B_HUMAN
• Pfam ID: PF06625
• Sequence:
  MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKR
  KRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRR
  TGQEVAQAQES

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Abetalipoproteinemia	DISMSS7T	Strong	Biomarker	[1]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
AIDS-related lymphoma	DISSLRAU	Strong	Biomarker	[4]
Autism	DISV4V1Z	Strong	Biomarker	[5]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[6]
Kaposi sarcoma	DISC1H1Z	Strong	Biomarker	[7]
Myotonic dystrophy	DISNBEMX	Strong	Altered Expression	[8]
Neoplasm	DISZKGEW	Strong	Altered Expression	[9]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[9]
Breast cancer	DIS7DPX1	moderate	Biomarker	[10]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[10]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[11]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[3]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[3]
Thyroid cancer	DIS3VLDH	Limited	Altered Expression	[9]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein FAM107B (FAM107B).	[12]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein FAM107B (FAM107B).	[13]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Protein FAM107B (FAM107B).	[14]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein FAM107B (FAM107B).	[15]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein FAM107B (FAM107B).	[16]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Protein FAM107B (FAM107B).	[18]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Protein FAM107B (FAM107B).	[19]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Protein FAM107B (FAM107B).	[20]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein FAM107B (FAM107B).	[21]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein FAM107B (FAM107B).	[22]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Protein FAM107B (FAM107B).	[23]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein FAM107B (FAM107B).	[24]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Protein FAM107B (FAM107B).	[25]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Protein FAM107B (FAM107B).	[26]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Protein FAM107B (FAM107B).	[19]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Protein FAM107B (FAM107B).	[19]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Protein FAM107B (FAM107B).	[27]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein FAM107B (FAM107B).	[19]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Protein FAM107B (FAM107B).	[28]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Protein FAM107B (FAM107B).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein FAM107B (FAM107B).	[32]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Protein FAM107B (FAM107B).	[27]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein FAM107B (FAM107B).	[17]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Protein FAM107B (FAM107B).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Protein FAM107B (FAM107B).	[31]

References

• [1] The Src/c-Abl pathway is a potential therapeutic target in amyotrophic lateral sclerosis.Sci Transl Med. 2017 May 24;9(391):eaaf3962. doi: 10.1126/scitranslmed.aaf3962.
• [2] Blood Stasis Imaging Predicts Cerebral Microembolism during Acute Myocardial Infarction.J Am Soc Echocardiogr. 2020 Mar;33(3):389-398. doi: 10.1016/j.echo.2019.09.020. Epub 2019 Dec 5.
• [3] FAM107B is regulated by S100A4 and mediates the effect of S100A4 on the proliferation and migration of MGC803 gastric cancer cells.Cell Biol Int. 2017 Oct;41(10):1103-1109. doi: 10.1002/cbin.10816. Epub 2017 Aug 29.
• [4] Ago HITS-CLIP expands understanding of Kaposi's sarcoma-associated herpesvirus miRNA function in primary effusion lymphomas. PLoS Pathog. 2012;8(8):e1002884.
• [5] HITS-CLIP and integrative modeling define the Rbfox splicing-regulatory network linked to brain development and autism.Cell Rep. 2014 Mar 27;6(6):1139-1152. doi: 10.1016/j.celrep.2014.02.005. Epub 2014 Mar 6.
• [6] HIV infection and hepatitis C virus genotype 1a are associated with phylogenetic clustering among people with recently acquired hepatitis C virus infection.Infect Genet Evol. 2016 Jan;37:252-8. doi: 10.1016/j.meegid.2015.11.028. Epub 2015 Nov 26.
• [7] HITS-CLIP analysis uncovers a link between the Kaposi's sarcoma-associated herpesvirus ORF57 protein and host pre-mRNA metabolism.PLoS Pathog. 2015 Feb 24;11(2):e1004652. doi: 10.1371/journal.ppat.1004652. eCollection 2015 Feb.
• [8] MBNL Sequestration by Toxic RNAs and RNA Misprocessing in the Myotonic Dystrophy Brain.Cell Rep. 2015 Aug 18;12(7):1159-68. doi: 10.1016/j.celrep.2015.07.029. Epub 2015 Aug 6.
• [9] Loss of HITS (FAM107B) expression in cancers of multiple organs: tissue microarray analysis.Int J Oncol. 2012 Oct;41(4):1347-57. doi: 10.3892/ijo.2012.1550. Epub 2012 Jul 10.
• [10] HITS-CLIP reveals key regulators of nuclear receptor signaling in breast cancer. Breast Cancer Res Treat. 2014 Jul;146(1):85-97.
• [11] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [12] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [13] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [14] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [15] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [16] Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
• [17] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [18] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [19] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [20] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [21] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [22] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [23] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [24] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [25] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [26] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [27] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [28] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [29] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [30] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [31] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [32] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.