Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT68M7RD)

• DOT Name: Macrophage colony-stimulating factor 1 (CSF1)
• Synonyms: CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; PG-M-CSF
• Gene Name: CSF1
• UniProt ID: CSF1_HUMAN
• PDB ID: 1HMC; 3UEZ; 3UF2; 4ADF; 4FA8; 4WRL; 4WRM; 5LXF
• Pfam ID: PF05337
• Sequence:
  MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
  TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
  SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
  QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
  LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
  TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
  DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
  AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
  HERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
  SPLTQDDRQVELPV
• Function: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  Ras sig.ling pathway (hsa04014)
  Rap1 sig.ling pathway (hsa04015)
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  PI3K-Akt sig.ling pathway (hsa04151)
  Osteoclast differentiation (hsa04380)
  Hematopoietic cell lineage (hsa04640)
  TNF sig.ling pathway (hsa04668)
  Alzheimer disease (hsa05010)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Rheumatoid arthritis (hsa05323)
• Reactome Pathway:
  Other interleukin signaling (R-HSA-449836)
  Interleukin-10 signaling (R-HSA-6783783)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Macrophage colony-stimulating factor 1 (CSF1) affects the response to substance of Fluorouracil.	[30]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Deoxythymidine	DMR90HY	Investigative	Macrophage colony-stimulating factor 1 (CSF1) increases the uptake of Deoxythymidine.	[19]

33 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[8]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[9]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[10]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[11]
Marinol	DM70IK5	Approved	Marinol increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[12]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[13]
Selenium	DM25CGV	Approved	Selenium increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[14]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[15]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[16]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[12]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[17]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[18]
Nitric Oxide	DM1RBYG	Approved	Nitric Oxide decreases the activity of Macrophage colony-stimulating factor 1 (CSF1).	[19]
Atazanavir	DMSYRBX	Approved	Atazanavir increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[18]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[21]
ANW-32821	DMMJOZD	Phase 2	ANW-32821 increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[23]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[24]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[25]
JWH-015	DMGTSCP	Patented	JWH-015 increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[12]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[26]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[1]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[27]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[28]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[7]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[29]
GW7604	DMCA4RM	Investigative	GW7604 increases the expression of Macrophage colony-stimulating factor 1 (CSF1).	[15]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Macrophage colony-stimulating factor 1 (CSF1).	[6]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Pexidartinib	DMS2J0Z	Approved	Pexidartinib decreases the secretion of Macrophage colony-stimulating factor 1 (CSF1).	[20]

References

• [1] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [7] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [8] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [9] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [10] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [11] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [12] Alcohol and Cannabinoids Differentially Affect HIV Infection and Function of Human Monocyte-Derived Dendritic Cells (MDDC). Front Microbiol. 2015 Dec 22;6:1452. doi: 10.3389/fmicb.2015.01452. eCollection 2015.
• [13] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [14] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [15] Gene expression profiles with activation of the estrogen receptor alpha-selective estrogen receptor modulator complex in breast cancer cells expressing wild-type estrogen receptor. Cancer Res. 2002 Aug 1;62(15):4419-26.
• [16] Folic acid modulates cancer-associated micro RNAs and inflammatory mediators in neoplastic and non-neoplastic colonic cells in a different way. Mol Nutr Food Res. 2017 Dec;61(12). doi: 10.1002/mnfr.201700260. Epub 2017 Nov 9.
• [17] Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
• [18] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [19] Enhanced production of nitric oxide by bone marrow cells and increased sensitivity to macrophage colony-stimulating factor (CSF) and granulocyte-macrophage CSF after benzene treatment of mice. Blood. 1994 Jun 1;83(11):3255-63.
• [20] Antitumor activity of a pexidartinib bioisostere inhibiting CSF1 production and CSF1R kinase activity in human hepatocellular carcinoma. Chem Biol Interact. 2023 Jan 5;369:110255. doi: 10.1016/j.cbi.2022.110255. Epub 2022 Nov 9.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses. J Biol Chem. 2015 Oct 16;290(42):25322-32. doi: 10.1074/jbc.M115.645234. Epub 2015 Aug 20.
• [23] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [24] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [25] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [26] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [27] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [28] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [29] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [30] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.