Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6K1ZD6)

DOT Name Opiorphin prepropeptide (OPRPN)
Synonyms Basic proline-rich lacrimal protein; Proline-rich protein 1; PRL1
Gene Name OPRPN
Related Disease
Analgesia ( )
Breast cancer ( )
Breast carcinoma ( )
Esophageal squamous cell carcinoma ( )
Liver failure ( )
Lung cancer ( )
Lung carcinoma ( )
Metastatic malignant neoplasm ( )
Hepatocellular carcinoma ( )
Neoplasm ( )
Castration-resistant prostate carcinoma ( )
Erectile dysfunction ( )
Melanoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Type-1/2 diabetes ( )
UniProt ID
PROL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15621
Sequence
MKLTFFLGLLALISCFTPSESQRFSRRPYLPGQLPPPPLYRPRWVPPSPPPPYDSRLNSP
LSLPFVPGRVPPSSFSRFSQAVILSQLFPLESIRQPRLFPGYPNLHFPLRPYYVGPIRIL
KPPFPPIPFFLAIYLPISNPEPQINITTADTTITTNPPTTATATTSTSTKPTMTISSSTV
PISSTPEPATSISAATPAASTENTTQILANRPHTVLLNATVQVTTSNQTILSSPAFKSFW
QKLFAIFG
Function
Opiorphin is an endogenous inhibitor of neprilysin and aminopeptidase N. Inhibits the breakdown of substance P, Mca-BK2 and Met-enkephalin by neprilysin in vitro with IC(50) values of 29 uM, 33 uM and 33 uM respectively. Inhibits the breakdown of Ala-pNA by aminopeptidase N in vitro with an IC(50) of 65 uM. Has a potent analgesic effect when administered to rats by intravenous injection.
Tissue Specificity Abundantly expressed in lacrimal gland where it found in the secretory endpieces. Also expressed at modest levels in the submandibular gland.

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Analgesia DISK3TVI Strong Genetic Variation [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [3]
Liver failure DISLGEL6 Strong Biomarker [4]
Lung cancer DISCM4YA Strong Biomarker [5]
Lung carcinoma DISTR26C Strong Biomarker [5]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [6]
Hepatocellular carcinoma DIS0J828 moderate Altered Expression [7]
Neoplasm DISZKGEW moderate Biomarker [2]
Castration-resistant prostate carcinoma DISVGAE6 Limited Biomarker [8]
Erectile dysfunction DISD8MTH Limited Altered Expression [9]
Melanoma DIS1RRCY Limited Genetic Variation [10]
Prostate cancer DISF190Y Limited Biomarker [8]
Prostate carcinoma DISMJPLE Limited Biomarker [8]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Opiorphin prepropeptide (OPRPN). [11]
------------------------------------------------------------------------------------

References

1 Calcium-binding protein, spermatid-specific 1 is expressed in human salivary glands and contains an anti-inflammatory motif.Am J Physiol Regul Integr Comp Physiol. 2015 Apr 1;308(7):R569-75. doi: 10.1152/ajpregu.00153.2014. Epub 2015 Jan 28.
2 pH protective Y(1) receptor ligand functionalized antiphagocytosis BPLP-WPU micelles for enhanced tumor imaging and therapy with prolonged survival time.Biomaterials. 2018 Jul;170:70-81. doi: 10.1016/j.biomaterials.2018.04.002. Epub 2018 Apr 4.
3 Expression of phosphatase of regenerating liver 1 and 3 mRNA in esophageal squamous cell carcinoma.Arch Pathol Lab Med. 2008 Aug;132(8):1307-12. doi: 10.5858/2008-132-1307-EOPORL.
4 Dynamic Regulation of miRNA Expression by Functionally Enhanced Placental Mesenchymal Stem Cells PromotesHepatic Regeneration in a Rat Model with Bile Duct Ligation.Int J Mol Sci. 2019 Oct 24;20(21):5299. doi: 10.3390/ijms20215299.
5 miR-339-5p Increases Radiosensitivity of Lung Cancer Cells by Targeting Phosphatases of Regenerating Liver-1 (PRL-1).Med Sci Monit. 2018 Nov 21;24:8408-8416. doi: 10.12659/MSM.910808.
6 Oncogenic function and prognostic significance of protein tyrosine phosphatase PRL-1 in hepatocellular carcinoma.Oncotarget. 2014 Jun 15;5(11):3685-96. doi: 10.18632/oncotarget.1986.
7 Exploring the cause of the inhibitor 4AX attaching to binding site disrupting protein tyrosine phosphatase 4A1 trimerization by molecular dynamic simulation.J Biomol Struct Dyn. 2019 Nov;37(18):4840-4851. doi: 10.1080/07391102.2019.1567392. Epub 2019 Jan 31.
8 Identification of PRL1 as a novel diagnostic and therapeutic target for castration-resistant prostate cancer by the Escherichia coli ampicillin secretion trap (CAST) method.Urol Oncol. 2014 Aug;32(6):769-78. doi: 10.1016/j.urolonc.2014.03.007. Epub 2014 Jun 23.
9 The opiorphin gene (ProL1) and its homologues function in erectile physiology.BJU Int. 2008 Sep;102(6):736-40. doi: 10.1111/j.1464-410X.2008.07631.x. Epub 2008 Apr 10.
10 Immune Cell-Mediated Biodegradable Theranostic Nanoparticles for Melanoma Targeting and Drug Delivery.Small. 2017 Mar;13(10):10.1002/smll.201603121. doi: 10.1002/smll.201603121. Epub 2016 Dec 27.
11 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.