Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6SK8ZV)

• DOT Name: GTP-binding protein GEM (GEM)
• Synonyms: GTP-binding mitogen-induced T-cell protein; RAS-like protein KIR
• Gene Name: GEM
• UniProt ID: GEM_HUMAN
• PDB ID: 2CJW; 2G3Y; 2HT6
• Pfam ID: PF00071
• Sequence:
  MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSS
  DSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMV
  DGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQ
  TEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR
  LRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL
• Function: Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity.
• Tissue Specificity: Most abundant in thymus, spleen, kidney, lung, and testis. Less abundant in heart, brain, liver and skeletal muscle.
• Reactome Pathway: NPAS4 regulates expression of target genes (R-HSA-9768919)

Molecular Interaction Atlas (MIA) of This DOT

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of GTP-binding protein GEM (GEM).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of GTP-binding protein GEM (GEM).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of GTP-binding protein GEM (GEM).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of GTP-binding protein GEM (GEM).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of GTP-binding protein GEM (GEM).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of GTP-binding protein GEM (GEM).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of GTP-binding protein GEM (GEM).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of GTP-binding protein GEM (GEM).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of GTP-binding protein GEM (GEM).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of GTP-binding protein GEM (GEM).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of GTP-binding protein GEM (GEM).	[11]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of GTP-binding protein GEM (GEM).	[12]
Marinol	DM70IK5	Approved	Marinol decreases the expression of GTP-binding protein GEM (GEM).	[13]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of GTP-binding protein GEM (GEM).	[14]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of GTP-binding protein GEM (GEM).	[15]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of GTP-binding protein GEM (GEM).	[16]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of GTP-binding protein GEM (GEM).	[17]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of GTP-binding protein GEM (GEM).	[18]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of GTP-binding protein GEM (GEM).	[19]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of GTP-binding protein GEM (GEM).	[20]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of GTP-binding protein GEM (GEM).	[21]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of GTP-binding protein GEM (GEM).	[22]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of GTP-binding protein GEM (GEM).	[23]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of GTP-binding protein GEM (GEM).	[25]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of GTP-binding protein GEM (GEM).	[26]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of GTP-binding protein GEM (GEM).	[27]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of GTP-binding protein GEM (GEM).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of GTP-binding protein GEM (GEM).	[29]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of GTP-binding protein GEM (GEM).	[1]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of GTP-binding protein GEM (GEM).	[30]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of GTP-binding protein GEM (GEM).	[31]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of GTP-binding protein GEM (GEM).	[32]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of GTP-binding protein GEM (GEM).	[33]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of GTP-binding protein GEM (GEM).	[34]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of GTP-binding protein GEM (GEM).	[24]

References

• [1] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [11] DNA microarray analysis of vitamin D-induced gene expression in a human colon carcinoma cell line. Physiol Genomics. 2004 Apr 13;17(2):122-9. doi: 10.1152/physiolgenomics.00002.2003.
• [12] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [13] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [14] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [15] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [16] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [17] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [18] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [19] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [20] Gene expression profile of the nucleus accumbens of human cocaine abusers: evidence for dysregulation of myelin. J Neurochem. 2004 Mar;88(5):1211-9. doi: 10.1046/j.1471-4159.2003.02247.x.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [23] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Torcetrapib induces aldosterone and cortisol production by an intracellular calcium-mediated mechanism independently of cholesteryl ester transfer protein inhibition. Endocrinology. 2009 May;150(5):2211-9.
• [28] Cadmium induces transcription independently of intracellular calcium mobilization. PLoS One. 2011;6(6):e20542.
• [29] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [30] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [31] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [32] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [33] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [34] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.