Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT78YX9J)

• DOT Name: Microtubule-associated protein 4 (MAP4)
• Synonyms: MAP-4
• Gene Name: MAP4
• UniProt ID: MAP4_HUMAN
• Pfam ID: PF00418
• Sequence:
  MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNS
  ESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWP
  EDTNFCFQPEQVVDPIQTDPFKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSP
  CNTAVVPQGWSVEALNSPHSESFVSPEAVAEPPQPTAVPLELAKEIEMASEERPPAQALE
  IMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDM
  ALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTLLKETERASPI
  KMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQ
  ANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQ
  LPETEIAPAKDVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEM
  EVALTEDQVPALKTEAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKG
  ISEDSHLESLQDVGQSAAPTFMISPETVTGTGKKCSLPAEEDSVLEKLGERKPCNSQPSE
  LSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKKTKPLATTQPAKTSTSKAKTQ
  PTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKDVKPKPIADAK
  APEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTE
  GKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPST
  TPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKT
  EAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGG
  GNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHL
  PAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREA
  QTLDSQIQETSI
• Function: Non-neuronal microtubule-associated protein. Promotes microtubule assembly.

Molecular Interaction Atlas (MIA) of This DOT

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Microtubule-associated protein 4 (MAP4).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Microtubule-associated protein 4 (MAP4).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Microtubule-associated protein 4 (MAP4).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Microtubule-associated protein 4 (MAP4).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Microtubule-associated protein 4 (MAP4).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Microtubule-associated protein 4 (MAP4).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Microtubule-associated protein 4 (MAP4).	[7]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Microtubule-associated protein 4 (MAP4).	[10]
Selenium	DM25CGV	Approved	Selenium increases the expression of Microtubule-associated protein 4 (MAP4).	[11]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Microtubule-associated protein 4 (MAP4).	[12]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Microtubule-associated protein 4 (MAP4).	[13]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Microtubule-associated protein 4 (MAP4).	[14]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Microtubule-associated protein 4 (MAP4).	[15]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Microtubule-associated protein 4 (MAP4).	[17]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Microtubule-associated protein 4 (MAP4).	[18]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Microtubule-associated protein 4 (MAP4).	[11]
APR-246	DMNFADH	Phase 2	APR-246 increases the expression of Microtubule-associated protein 4 (MAP4).	[19]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Microtubule-associated protein 4 (MAP4).	[22]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Microtubule-associated protein 4 (MAP4).	[24]

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Microtubule-associated protein 4 (MAP4).	[8]
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of Microtubule-associated protein 4 (MAP4).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Microtubule-associated protein 4 (MAP4).	[20]
TAK-243	DM4GKV2	Phase 1	TAK-243 affects the sumoylation of Microtubule-associated protein 4 (MAP4).	[21]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Microtubule-associated protein 4 (MAP4).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Microtubule-associated protein 4 (MAP4).	[23]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Microtubule-associated protein 4 (MAP4).	[9]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Microtubule-associated protein 4 (MAP4).	[16]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [9] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [10] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [11] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [12] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [13] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [14] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [15] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [16] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [17] Differential expression of genes induced by resveratrol in LNCaP cells: P53-mediated molecular targets. Int J Cancer. 2003 Mar 20;104(2):204-12.
• [18] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [19] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [20] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [21] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [22] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [23] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [24] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.