General Information of Drug Off-Target (DOT) (ID: OT7XNL0K)

DOT Name Cardiolipin synthase (CRLS1)
Synonyms CMP-forming; CLS; EC 2.7.8.41; Protein GCD10 homolog
Gene Name CRLS1
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Breast fibrocystic disease ( )
Coffin-Lowry syndrome ( )
Colitis ( )
Colorectal carcinoma ( )
Combined oxidative phosphorylation deficiency 57 ( )
Depression ( )
Ductal carcinoma ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Paroxysmal nocturnal haemoglobinuria ( )
Schizophrenia ( )
Sexually transmitted infection ( )
Vascular dementia ( )
Pneumonia ( )
Wilms tumor ( )
UniProt ID
CRLS1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.7.8.41
Pfam ID
PF01066
Sequence
MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRL
PGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGL
APVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISIL
YVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTF
ISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIK
D
Function
Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a key phospholipid in mitochondrial membranes and plays important roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stress conditions.
Tissue Specificity Highly expressed in tissues such as heart, skeletal muscle and liver.
KEGG Pathway
Glycerophospholipid metabolism (hsa00564 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of CL (R-HSA-1483076 )
Acyl chain remodelling of PG (R-HSA-1482925 )

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Genetic Variation [1]
Breast carcinoma DIS2UE88 Strong Genetic Variation [1]
Breast fibrocystic disease DISUM7ID Strong Biomarker [1]
Coffin-Lowry syndrome DISMTBDA Strong Biomarker [2]
Colitis DISAF7DD Strong Biomarker [3]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [4]
Combined oxidative phosphorylation deficiency 57 DISXH312 Strong Autosomal recessive [5]
Depression DIS3XJ69 Strong Biomarker [6]
Ductal carcinoma DIS15EA5 Strong Biomarker [4]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [7]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [8]
Lung adenocarcinoma DISD51WR Strong Altered Expression [9]
Lung cancer DISCM4YA Strong Altered Expression [9]
Lung carcinoma DISTR26C Strong Altered Expression [9]
Neoplasm DISZKGEW Strong Altered Expression [9]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [9]
Paroxysmal nocturnal haemoglobinuria DISBHMYH Strong Biomarker [10]
Schizophrenia DISSRV2N Strong Biomarker [11]
Sexually transmitted infection DISIVIAL Strong Biomarker [7]
Vascular dementia DISVO82H Strong Altered Expression [12]
Pneumonia DIS8EF3M Limited Biomarker [13]
Wilms tumor DISB6T16 Limited Altered Expression [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cardiolipin synthase (CRLS1). [15]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the methylation of Cardiolipin synthase (CRLS1). [25]
------------------------------------------------------------------------------------
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cardiolipin synthase (CRLS1). [16]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cardiolipin synthase (CRLS1). [17]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cardiolipin synthase (CRLS1). [18]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Cardiolipin synthase (CRLS1). [19]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Cardiolipin synthase (CRLS1). [20]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Cardiolipin synthase (CRLS1). [21]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Cardiolipin synthase (CRLS1). [22]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Cardiolipin synthase (CRLS1). [23]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Cardiolipin synthase (CRLS1). [24]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Cardiolipin synthase (CRLS1). [26]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Cardiolipin synthase (CRLS1). [27]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Cardiolipin synthase (CRLS1). [28]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Cardiolipin synthase (CRLS1). [29]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Cardiolipin synthase (CRLS1). [30]
Forskolin DM6ITNG Investigative Forskolin increases the expression of Cardiolipin synthase (CRLS1). [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)

References

1 Macrophagic "Crown-like Structures" Are Associated with an Increased Risk of Breast Cancer in Benign Breast Disease.Cancer Prev Res (Phila). 2018 Feb;11(2):113-119. doi: 10.1158/1940-6207.CAPR-17-0245. Epub 2017 Nov 22.
2 Adult with an interstitial deletion of chromosome 10 [del(10)(q25. 1q25.3)]: overlap with Coffin-Lowry syndrome.Am J Med Genet. 2000 Nov 13;95(2):93-8. doi: 10.1002/1096-8628(20001113)95:2<93::aid-ajmg1>3.0.co;2-b.
3 Effect of a probiotic beverage consumption (Enterococcus faecium CRL 183 and Bifidobacterium longum ATCC 15707) in rats with chemically induced colitis.PLoS One. 2017 Apr 24;12(4):e0175935. doi: 10.1371/journal.pone.0175935. eCollection 2017.
4 Mutational Profiling Can Establish Clonal or Independent Origin in Synchronous Bilateral Breast and Other Tumors.PLoS One. 2015 Nov 10;10(11):e0142487. doi: 10.1371/journal.pone.0142487. eCollection 2015.
5 Deleterious variants in CRLS1 lead to cardiolipin deficiency and cause an autosomal recessive multi-system mitochondrial disease. Hum Mol Genet. 2022 Oct 28;31(21):3597-3612. doi: 10.1093/hmg/ddac040.
6 Investigating Conceptual Models for the Relationship Between Depression and Condomless Sex Among Gay, Bisexual, and Other Men Who have Sex with Men: Using Structural Equation Modelling to Assess Mediation.AIDS Behav. 2020 Jun;24(6):1793-1806. doi: 10.1007/s10461-019-02724-0.
7 Condomless sex in HIV-diagnosed men who have sex with men in the UK: prevalence, correlates, and implications for HIV transmission.Sex Transm Infect. 2017 Dec;93(8):590-598. doi: 10.1136/sextrans-2016-053029. Epub 2017 Jul 5.
8 Small regulatory polypeptide of amino acid response negatively relates to poor prognosis and controls hepatocellular carcinoma progression via regulating microRNA-5581-3p/human cardiolipin synthase 1.J Cell Physiol. 2019 Aug;234(10):17589-17599. doi: 10.1002/jcp.28383. Epub 2019 Mar 1.
9 Expression and potential mechanism of metabolism-related genes and CRLS1 in non-small cell lung cancer.Oncol Lett. 2018 Feb;15(2):2661-2668. doi: 10.3892/ol.2017.7591. Epub 2017 Dec 12.
10 The use of monoclonal antibodies and flow cytometry in the diagnosis of paroxysmal nocturnal hemoglobinuria.Blood. 1996 Jun 15;87(12):5332-40.
11 Mental imagery vividness as a trait marker across the schizophrenia spectrum.Psychiatry Res. 2009 May 15;167(1-2):1-11. doi: 10.1016/j.psychres.2007.12.008. Epub 2009 Apr 3.
12 Involvement of Endothelin-1, H(2)S and Nrf2 in Beneficial Effects of Remote Ischemic Preconditioning in Global Cerebral Ischemia-Induced Vascular Dementia in Mice.Cell Mol Neurobiol. 2019 Jul;39(5):671-686. doi: 10.1007/s10571-019-00670-y. Epub 2019 Apr 25.
13 E3 ligase subunit Fbxo15 and PINK1 kinase regulate cardiolipin synthase 1 stability and mitochondrial function in pneumonia.Cell Rep. 2014 Apr 24;7(2):476-487. doi: 10.1016/j.celrep.2014.02.048. Epub 2014 Apr 3.
14 miR-140-5p could suppress tumor proliferation and progression by targeting TGFBRI/SMAD2/3 and IGF-1R/AKT signaling pathways in Wilms' tumor.BMC Cancer. 2019 Apr 29;19(1):405. doi: 10.1186/s12885-019-5609-1.
15 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
16 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
17 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
18 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
19 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
20 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
21 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
22 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
23 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
24 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
25 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
26 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
27 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
28 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
29 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
30 Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells. Oncogene. 2006 Nov 23;25(55):7311-23.