Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8MCRNY)

• DOT Name: ATPase family AAA domain-containing protein 2 (ATAD2)
• Synonyms: EC 3.6.1.-; AAA nuclear coregulator cancer-associated protein; ANCCA
• Gene Name: ATAD2
• UniProt ID: ATAD2_HUMAN
• PDB ID: 3DAI ; 4QSP ; 4QSQ ; 4QSR ; 4QSS ; 4QST ; 4QSU ; 4QSV ; 4QSW ; 4QSX ; 4QUT ; 4QUU ; 4TT2 ; 4TT4 ; 4TT6 ; 4TTE ; 4TU4 ; 4TU6 ; 4TYL ; 4TZ2 ; 4TZ8 ; 5A5N ; 5A5O ; 5A5P ; 5A5Q ; 5A5R ; 5A81 ; 5A82 ; 5A83 ; 5EPB ; 5F36 ; 5F3A ; 5LJ0 ; 5QXI ; 5QXJ ; 5QXK ; 5QXL ; 5QXM ; 5QXN ; 5QXO ; 5QXP ; 5QXQ ; 5QXR ; 5QXS ; 5QXT ; 5QXU ; 5QXV ; 5QXW ; 5QXX ; 5QXY ; 5QXZ ; 5QY0 ; 5R4E ; 5R4F ; 5R4V ; 5R4W ; 5R4X ; 5R4Y ; 5R4Z ; 6CPS ; 6EPJ ; 6EPR ; 6EPS ; 6EPT ; 6EPU ; 6EPV ; 6EPW ; 6EPX ; 6HDN ; 6HDO ; 6HI3 ; 6HI4 ; 6HI5 ; 6HI6 ; 6HI7 ; 6HI8 ; 6HIA ; 6HIB ; 6HIC ; 6HID ; 6HIE ; 6S55 ; 6S56 ; 6S57 ; 6YB4 ; 7M98 ; 7PPX ; 7PX5 ; 7Q6T ; 7Q6U ; 7Q6V ; 7Q6W ; 7QU7 ; 7QUK ; 7QUM ; 7QWO ; 7QX1 ; 7QXT ; 7QYK ; 7QYL ; 7QZM ; 7QZY ; 7QZZ ; 7R00 ; 7R05 ; 7R0Y ; 7Z9H ; 7Z9I ; 7Z9J ; 7Z9N ; 7Z9O ; 7Z9S ; 7Z9U ; 8H3H ; 8JUW ; 8JUY ; 8JUZ
• EC Number: 3.6.1.-
• Pfam ID: PF00004 ; PF17862 ; PF00439
• Sequence:
  MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGS
  SVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEE
  HREDKVIPVTRSLRARNIVQSTEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNT
  AEAVLQKMDDMKKMRRQRMRELEDLGVFNETEESNLNMYTRGKQKDIQRTDEETTDNQEG
  SVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDDEDEEDGEEENQKRYYLRQRK
  ATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNRRRHAIHSSDS
  TSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD
  SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARAL
  ANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVR
  SSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPD
  KEARKEILKIHTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYT
  TSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEAL
  QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHL
  NRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE
  TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPH
  SALPEEVQELFIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLP
  VAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD
  YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACA
  LRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSD
  PEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHKIES
  DTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA
  CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILS
  QPTPSLVVDHERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKME
  QEVENFSCSR
• Function: May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.
• Tissue Specificity: Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors.
• Reactome Pathway: TFAP2 (AP-2) family regulates transcription of growth factors and their receptors (R-HSA-8866910)

Molecular Interaction Atlas (MIA) of This DOT

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[11]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[12]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[13]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[14]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[15]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[16]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[17]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[18]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[18]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[19]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[18]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[20]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[21]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[22]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[8]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[23]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[26]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[29]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[30]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of ATPase family AAA domain-containing protein 2 (ATAD2).	[22]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of ATPase family AAA domain-containing protein 2 (ATAD2).	[10]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of ATPase family AAA domain-containing protein 2 (ATAD2).	[25]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of ATPase family AAA domain-containing protein 2 (ATAD2).	[27]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of ATPase family AAA domain-containing protein 2 (ATAD2).	[27]

References

• [1] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [11] Combination of arsenic trioxide and Dasatinib: a new strategy to treat Philadelphia chromosome-positive acute lymphoblastic leukaemia. J Cell Mol Med. 2018 Mar;22(3):1614-1626.
• [12] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [13] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [14] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [15] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [16] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [17] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [18] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [19] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [20] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [21] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [22] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [23] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [24] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [25] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [28] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [29] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [30] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.