Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9L87U9)

DOT Name Mammaglobin-B (SCGB2A1)
Synonyms Lacryglobin; Lipophilin-C; Mammaglobin-2; Secretoglobin family 2A member 1
Gene Name SCGB2A1
Related Disease
Advanced cancer ( )
Allergic rhinitis ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Cholangiocarcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Epithelial ovarian cancer ( )
Gastric cancer ( )
Metastatic malignant neoplasm ( )
Nasal polyp ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Stomach cancer ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Endometrium neoplasm ( )
Breast neoplasm ( )
UniProt ID
SG2A1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01099
Sequence
MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMG
KFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
Function May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
Tissue Specificity Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Allergic rhinitis DIS3U9HN Strong Altered Expression [2]
Breast cancer DIS7DPX1 Strong Altered Expression [3]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Carcinoma DISH9F1N Strong Biomarker [5]
Cholangiocarcinoma DIS71F6X Strong Altered Expression [6]
Colon cancer DISVC52G Strong Altered Expression [6]
Colon carcinoma DISJYKUO Strong Altered Expression [6]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [1]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [7]
Gastric cancer DISXGOUK Strong Biomarker [6]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [4]
Nasal polyp DISLP3XE Strong Altered Expression [2]
Ovarian cancer DISZJHAP Strong Biomarker [7]
Ovarian neoplasm DISEAFTY Strong Biomarker [7]
Stomach cancer DISKIJSX Strong Biomarker [6]
Endometrial cancer DISW0LMR moderate Biomarker [8]
Endometrial carcinoma DISXR5CY moderate Biomarker [8]
Endometrium neoplasm DIS6OS2L moderate Altered Expression [8]
Breast neoplasm DISNGJLM Limited Biomarker [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Mammaglobin-B (SCGB2A1). [10]
Progesterone DMUY35B Approved Progesterone increases the expression of Mammaglobin-B (SCGB2A1). [11]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Mammaglobin-B (SCGB2A1). [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Mammaglobin-B (SCGB2A1). [13]
------------------------------------------------------------------------------------

References

1 SCGB2A1 is a novel prognostic marker for colorectal cancer associated with chemoresistance and radioresistance.Int J Oncol. 2014 May;44(5):1521-8. doi: 10.3892/ijo.2014.2316. Epub 2014 Feb 28.
2 Expression of mammaglobins A and B in nasal polyps is similar in patients with and without allergic rhinitis.Am J Rhinol. 2008 Mar-Apr;22(2):135-8. doi: 10.2500/ajr.2008.22.3138.
3 In vitro selections of mammaglobin A and mammaglobin B aptamers for the recognition of circulating breast tumor cells.Sci Rep. 2017 Nov 3;7(1):14487. doi: 10.1038/s41598-017-13751-z.
4 RT-PCR for mammaglobin genes, MGB1 and MGB2, identifies breast cancer micrometastases in sentinel lymph nodes.Am J Clin Pathol. 2004 May;121(5):637-43. doi: 10.1309/MMAC-TXT5-5L8Q-TKC1.
5 Genetic detection for micrometastasis in lymph node of biliary tract carcinoma.Clin Cancer Res. 2000 Jun;6(6):2326-32.
6 Mammaglobin B gene as a novel marker for lymph node micrometastasis in patients with abdominal cancers.Cancer Lett. 2000 Mar 13;150(1):79-84. doi: 10.1016/s0304-3835(99)00378-x.
7 Machine learning and bioinformatics models to identify gene expression patterns of ovarian cancer associated with disease progression and mortality.J Biomed Inform. 2019 Dec;100:103313. doi: 10.1016/j.jbi.2019.103313. Epub 2019 Oct 23.
8 Mammaglobin B expression in human endometrial cancer.Int J Gynecol Cancer. 2008 Sep-Oct;18(5):1090-6. doi: 10.1111/j.1525-1438.2007.01137.x. Epub 2007 Nov 16.
9 Identification of mammaglobin as a novel serum marker for breast cancer.Clin Cancer Res. 2005 Sep 15;11(18):6528-35. doi: 10.1158/1078-0432.CCR-05-0415.
10 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
11 Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
12 Secretoglobin 2A1 is under selective androgen control mediated by a peculiar binding site for Sp family transcription factors. Mol Endocrinol. 2005 Dec;19(12):2964-78. doi: 10.1210/me.2004-0408. Epub 2005 Jul 14.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.