Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCKMP49)

• DOT Name: Signal transducer and activator of transcription 6 (STAT6)
• Synonyms: IL-4 Stat
• Gene Name: STAT6
• UniProt ID: STAT6_HUMAN
• PDB ID: 1OJ5; 4Y5U; 4Y5W; 5D39; 5NWM; 5NWX
• Pfam ID: PF00017 ; PF14596 ; PF01017 ; PF02864 ; PF02865 ; PF21354
• Sequence:
  MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
  VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
  FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
  MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
  EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
  FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
  KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
  NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
  IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
  FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
  SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
  LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
  PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
  PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
  LRANPSW
• Function: Carries out a dual signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling.
• KEGG Pathway:
  Necroptosis (hsa04217)
  JAK-STAT sig.ling pathway (hsa04630)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  Hepatitis B (hsa05161)
  Pathways in cancer (hsa05200)
  Inflammatory bowel disease (hsa05321)
• Reactome Pathway:
  STAT6-mediated induction of chemokines (R-HSA-3249367)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Downstream signal transduction (R-HSA-186763)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Morphine	DMRMS0L	Approved	Signal transducer and activator of transcription 6 (STAT6) affects the response to substance of Morphine.	[35]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Signal transducer and activator of transcription 6 (STAT6).	[11]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[12]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[10]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[14]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Signal transducer and activator of transcription 6 (STAT6).	[11]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[15]
Vitamin C	DMXJ7O8	Approved	Vitamin C affects the expression of Signal transducer and activator of transcription 6 (STAT6).	[17]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[18]
Ergotidine	DM78IME	Approved	Ergotidine increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[9]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[19]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[10]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[20]
Contigoside B	DMX9V8K	Phase 2/3	Contigoside B increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[17]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[23]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[24]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[28]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[30]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Signal transducer and activator of transcription 6 (STAT6).	[31]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[32]
Rutin	DMEHRAJ	Investigative	Rutin increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[33]
CATECHIN	DMY38SB	Investigative	CATECHIN increases the expression of Signal transducer and activator of transcription 6 (STAT6).	[33]

9 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[6]
Marinol	DM70IK5	Approved	Marinol increases the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[13]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[16]
Fidarestat	DMZL1I8	Phase 3	Fidarestat decreases the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Signal transducer and activator of transcription 6 (STAT6).	[22]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[25]
MG-132	DMKA2YS	Preclinical	MG-132 affects the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[26]
Deguelin	DMXT7WG	Investigative	Deguelin increases the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[29]
Tetramethylbutylphenol	DMW9CH2	Investigative	Tetramethylbutylphenol increases the phosphorylation of Signal transducer and activator of transcription 6 (STAT6).	[34]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Direct and indirect effects of retinoic acid on human Th2 cytokine and chemokine expression by human T lymphocytes. BMC Immunol. 2006 Nov 21;7:27. doi: 10.1186/1471-2172-7-27.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Platinum-based drugs disrupt STAT6-mediated suppression of immune responses against cancer in humans and mice. J Clin Invest. 2011 Aug;121(8):3100-8. doi: 10.1172/JCI43656. Epub 2011 Jul 18.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Pyrethroid insecticides influence the signal transduction in T helper lymphocytes from atopic and nonatopic subjects. Inflamm Res. 2003 Apr;52(4):154-63. doi: 10.1007/s000110300066.
• [10] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [11] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [12] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [13] Cannabinoid receptor type 2 agonists induce transcription of the mu-opioid receptor gene in Jurkat T cells. Mol Pharmacol. 2006 Apr;69(4):1486-91. doi: 10.1124/mol.105.018325. Epub 2006 Jan 24.
• [14] Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
• [15] Nicotine and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone induce cyclooxygenase-2 activity in human gastric cancer cells: involvement of nicotinic acetylcholine receptor (nAChR) and beta-adrenergic receptor signaling pathways. Toxicol Appl Pharmacol. 2008 Dec 1;233(2):254-61.
• [16] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [17] Improved Preventive Effects of Combined Bioactive Compounds Present in Different Blueberry Varieties as Compared to Single Phytochemicals. Nutrients. 2018 Dec 29;11(1):61. doi: 10.3390/nu11010061.
• [18] Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
• [19] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [20] Control of eotaxin-1 expression and release by resveratrol and its metabolites in culture human pulmonary artery endothelial cells. Am J Cardiovasc Dis. 2011;1(1):16-30. Epub 2011 Apr 26.
• [21] Aldose reductase inhibition prevents metaplasia of airway epithelial cells. PLoS One. 2010 Dec 28;5(12):e14440. doi: 10.1371/journal.pone.0014440.
• [22] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [23] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [24] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [25] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [26] Regulation of the dephosphorylation of Stat6. Participation of Tyr-713 in the interleukin-4 receptor alpha, the tyrosine phosphatase SHP-1, and the proteasome. J Biol Chem. 2003 Feb 7;278(6):3903-11. doi: 10.1074/jbc.M211747200. Epub 2002 Nov 28.
• [27] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [28] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [29] A novel derivative of the natural agent deguelin for cancer chemoprevention and therapy. Cancer Prev Res (Phila). 2008 Dec;1(7):577-87. doi: 10.1158/1940-6207.CAPR-08-0184.
• [30] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [31] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [32] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [33] Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
• [34] Oncogenic Potential of Bisphenol A and Common Environmental Contaminants in Human Mammary Epithelial Cells. Int J Mol Sci. 2020 May 25;21(10):3735. doi: 10.3390/ijms21103735.
• [35] Clinical response to morphine in cancer patients and genetic variation in candidate genes. Pharmacogenomics J. 2005;5(5):324-36. doi: 10.1038/sj.tpj.6500327.