Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEGL17Z)

DOT Name	Integral membrane protein DGCR2/IDD (DGCR2)
Gene Name	DGCR2
Related Disease	Myocardial infarction ( ) Acromegaly ( ) Amyloidosis ( ) Autism spectrum disorder ( ) Autoimmune disease ( ) Cervix disorder ( ) Cowden disease ( ) Hypoparathyroidism ( ) Intervertebral disc degeneration ( ) Metastatic malignant neoplasm ( ) Myotonic dystrophy type 1 ( ) Neoplasm ( ) Osteoporosis ( ) Shprintzen-Goldberg syndrome ( ) Type-1/2 diabetes ( ) DiGeorge syndrome ( ) Prune belly syndrome ( ) Intellectual disability ( ) Primary biliary cholangitis ( ) Bipolar disorder ( ) Neurodevelopmental disorder ( ) Schizophrenia ( ) Type-1 diabetes ( ) Velocardiofacial syndrome ( )
UniProt ID	IDD_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00057 ; PF00059
Sequence	MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQCDGWATCEDE SDEANCPEVTGEVRPHHGKEAVDPRQGRARGGDPSHFHAVNVAQPVRFSSFLGKCPTGWH HYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKD QRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFH FPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHG GEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFDSMASGMRLVVSCISSFLI LSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGE GGTFHFHDPPPPYTAYKYPDIGQPDDPPPPYEASIHPDSVFYDPADDDAFEPVEVSLPAP GDGGSEGALLRRLEQPLPTAGASLADLEDSADSSSALLVPPDPAQSGSTPAAEALPGGGR HSRSSLNTVV
Function	Putative adhesion receptor, that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.
Tissue Specificity	Predominantly expressed in brain, heart, lung and fetal kidney. Low levels in liver and adult kidney.

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Myocardial infarction	DIS655KI	Definitive	Genetic Variation	[1]
Acromegaly	DISCC73U	Strong	Biomarker	[2]
Amyloidosis	DISHTAI2	Strong	Biomarker	[3]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[4]
Autoimmune disease	DISORMTM	Strong	Biomarker	[5]
Cervix disorder	DIS1HG31	Strong	Biomarker	[6]
Cowden disease	DISMYKCE	Strong	Biomarker	[7]
Hypoparathyroidism	DISICS0V	Strong	Genetic Variation	[8]
Intervertebral disc degeneration	DISG3AIM	Strong	Biomarker	[9]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[10]
Myotonic dystrophy type 1	DISJC0OX	Strong	Genetic Variation	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Osteoporosis	DISF2JE0	Strong	Biomarker	[12]
Shprintzen-Goldberg syndrome	DISQH6P3	Strong	Biomarker	[13]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[14]
DiGeorge syndrome	DIST1RKO	moderate	Biomarker	[13]
Prune belly syndrome	DISBIBMN	moderate	Biomarker	[15]
Intellectual disability	DISMBNXP	Disputed	Genetic Variation	[16]
Primary biliary cholangitis	DIS43E0O	Disputed	Biomarker	[17]
Bipolar disorder	DISAM7J2	Limited	Biomarker	[18]
Neurodevelopmental disorder	DIS372XH	Limited	Biomarker	[18]
Schizophrenia	DISSRV2N	Limited	Autosomal dominant	[19]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[20]
Velocardiofacial syndrome	DISOSBTY	Limited	Biomarker	[21]
------------------------------------------------------------------------------------


⏷ Show the Full List of 24 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Integral membrane protein DGCR2/IDD (DGCR2).	[22]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Integral membrane protein DGCR2/IDD (DGCR2).	[23]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Integral membrane protein DGCR2/IDD (DGCR2).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Integral membrane protein DGCR2/IDD (DGCR2).	[26]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Integral membrane protein DGCR2/IDD (DGCR2).	[24]
------------------------------------------------------------------------------------

References

1	Platelet GPIbalpha, GPIV and vWF polymorphisms and fatal pre-hospital MI among middle-aged men.J Thromb Thrombolysis. 2008 Oct;26(2):91-6. doi: 10.1007/s11239-007-0072-2. Epub 2007 Jul 11.
2	Screening for comorbid conditions in patients enrolled in the SODA registry: a 2-year observational analysis.Endocrine. 2018 Jul;61(1):105-117. doi: 10.1007/s12020-018-1615-3. Epub 2018 May 16.
3	Effects of Acetylcholine on -Amyloid-Induced cPLA2 Activation in the TB Neuroectodermal Cell Line: Implications for the Pathogenesis of Alzheimer's Disease.Cell Mol Neurobiol. 2018 May;38(4):817-826. doi: 10.1007/s10571-017-0555-4. Epub 2017 Oct 9.
4	Young children who screen positive for autism: Stability, change and "comorbidity" over two years.Res Dev Disabil. 2018 Jan;72:297-307. doi: 10.1016/j.ridd.2016.10.004. Epub 2016 Nov 3.
5	Genetic control of autoimmune diabetes in the NOD mouse.Annu Rev Immunol. 1995;13:179-200. doi: 10.1146/annurev.iy.13.040195.001143.
6	Current practice and usual care of major cervical disorders in Korea: A cross-sectional study of Korean health insurance review and assessment service national patient sample data.Medicine (Baltimore). 2017 Nov;96(46):e8751. doi: 10.1097/MD.0000000000008751.
7	Cytosine deaminase/5-fluorocytosine gene therapy and Apo2L/TRAIL cooperate to kill TRAIL-resistant tumor cells.Cancer Gene Ther. 2007 Jul;14(7):640-51. doi: 10.1038/sj.cgt.7701051. Epub 2007 Apr 20.
8	Expression and mutation analysis of BRUNOL3, a candidate gene for heart and thymus developmental defects associated with partial monosomy 10p.J Mol Med (Berl). 2002 Jul;80(7):431-42. doi: 10.1007/s00109-002-0331-9. Epub 2002 Apr 4.
9	Ligustilide alleviated IL-1 induced apoptosis and extracellular matrix degradation of nucleus pulposus cells and attenuates intervertebral disc degeneration in vivo.Int Immunopharmacol. 2019 Apr;69:398-407. doi: 10.1016/j.intimp.2019.01.004. Epub 2019 Feb 18.
10	Cell adhesion molecules in metastatic neuroblastoma models.Clin Exp Metastasis. 2014 Apr;31(4):483-96. doi: 10.1007/s10585-014-9643-8. Epub 2014 Feb 19.
11	Folate receptor-targeted lipid-albumin nanoparticles (F-LAN) for therapeutic delivery of an Akt1 antisense oligonucleotide.J Drug Target. 2018 Jun-Jul;26(5-6):466-473. doi: 10.1080/1061186X.2018.1433678. Epub 2018 Feb 8.
12	Low-trauma fractures and bone mineral density testing in adults with and without intellectual and developmental disabilities: a population study.Osteoporos Int. 2017 Feb;28(2):727-732. doi: 10.1007/s00198-016-3740-2. Epub 2016 Sep 9.
13	The Candidate Schizophrenia Risk Gene DGCR2 Regulates Early Steps of Corticogenesis.Biol Psychiatry. 2018 Apr 15;83(8):692-706. doi: 10.1016/j.biopsych.2017.11.015. Epub 2017 Nov 21.
14	A new indanedione derivative alleviates symptoms of diabetes by modulating RAGE-NF-kappaB pathway in db/db mice.Biochem Biophys Res Commun. 2018 Jul 2;501(4):863-870. doi: 10.1016/j.bbrc.2018.05.043. Epub 2018 May 21.
15	Oncolytic herpes simplex virus mutants are more efficacious than wild-type adenovirus Type 5 for the treatment of high-risk neuroblastomas in preclinical models.Pediatr Blood Cancer. 2005 May;44(5):469-78. doi: 10.1002/pbc.20268.
16	Diagnosis of Van den Ende-Gupta syndrome: Approach to the Marden-Walker-like spectrum of disorders.Am J Med Genet A. 2016 Sep;170(9):2310-21. doi: 10.1002/ajmg.a.37831. Epub 2016 Jul 4.
17	CD8 T cells mediate direct biliary ductule damage in nonobese diabetic autoimmune biliary disease.J Immunol. 2011 Jan 15;186(2):1259-67. doi: 10.4049/jimmunol.1001597. Epub 2010 Dec 17.
18	Modeling the neuropsychiatric manifestations of Lowe syndrome using induced pluripotent stem cells: defective F-actin polymerization and WAVE-1 expression in neuronal cells.Mol Autism. 2018 Aug 15;9:44. doi: 10.1186/s13229-018-0227-3. eCollection 2018.
19	Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
20	Phylogenetic analysis of IDD gene family and characterization of its expression in response to flower induction in Malus.Mol Genet Genomics. 2017 Aug;292(4):755-771. doi: 10.1007/s00438-017-1306-4. Epub 2017 Mar 17.
21	An HDR (hypoparathyroidism, deafness, renal dysplasia) syndrome locus maps distal to the DiGeorge syndrome region on 10p13/14.J Med Genet. 2000 Jan;37(1):33-7. doi: 10.1136/jmg.37.1.33.
22	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
23	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
24	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
25	Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
26	The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.