Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEXDEJN)

DOT Name GA-binding protein subunit beta-1 (GABPB1)
Synonyms GABP subunit beta-1; GABPB-1; GABP subunit beta-2; GABPB-2; Nuclear respiratory factor 2; Transcription factor E4TF1-47; Transcription factor E4TF1-53
Gene Name GABPB1
Related Disease
Hepatocellular carcinoma ( )
Adult glioblastoma ( )
Advanced cancer ( )
Clear cell renal carcinoma ( )
Glioblastoma multiforme ( )
Kidney cancer ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Renal carcinoma ( )
Renal cell carcinoma ( )
UniProt ID
GABP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12796
Sequence
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTGLVSSENSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNS
SETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVT
MPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANRE
AQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV
Function
Transcription factor capable of interacting with purine rich repeats (GA repeats). Acts as a master regulator of nuclear-encoded mitochondrial genes; (Microbial infection) Necessary for the expression of the Adenovirus E4 gene.
Reactome Pathway
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatocellular carcinoma DIS0J828 Definitive Biomarker [1]
Adult glioblastoma DISVP4LU moderate Biomarker [2]
Advanced cancer DISAT1Z9 moderate Altered Expression [2]
Clear cell renal carcinoma DISBXRFJ moderate Biomarker [3]
Glioblastoma multiforme DISK8246 moderate Biomarker [2]
Kidney cancer DISBIPKM moderate Altered Expression [3]
Neoplasm DISZKGEW moderate Altered Expression [2]
Non-insulin dependent diabetes DISK1O5Z moderate Genetic Variation [4]
Obesity DIS47Y1K moderate Genetic Variation [4]
Renal carcinoma DISER9XT moderate Altered Expression [3]
Renal cell carcinoma DISQZ2X8 moderate Biomarker [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of GA-binding protein subunit beta-1 (GABPB1). [5]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of GA-binding protein subunit beta-1 (GABPB1). [6]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of GA-binding protein subunit beta-1 (GABPB1). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of GA-binding protein subunit beta-1 (GABPB1). [8]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of GA-binding protein subunit beta-1 (GABPB1). [9]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of GA-binding protein subunit beta-1 (GABPB1). [5]
Decitabine DMQL8XJ Approved Decitabine affects the expression of GA-binding protein subunit beta-1 (GABPB1). [9]
Seocalcitol DMKL9QO Phase 3 Seocalcitol decreases the expression of GA-binding protein subunit beta-1 (GABPB1). [10]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of GA-binding protein subunit beta-1 (GABPB1). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of GA-binding protein subunit beta-1 (GABPB1). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of GA-binding protein subunit beta-1 (GABPB1). [14]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of GA-binding protein subunit beta-1 (GABPB1). [15]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of GA-binding protein subunit beta-1 (GABPB1). [16]
Deguelin DMXT7WG Investigative Deguelin increases the expression of GA-binding protein subunit beta-1 (GABPB1). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of GA-binding protein subunit beta-1 (GABPB1). [12]
------------------------------------------------------------------------------------

References

1 LncRNA GABPB1-AS1 and GABPB1 regulate oxidative stress during erastin-induced ferroptosis in HepG2 hepatocellular carcinoma cells.Sci Rep. 2019 Nov 7;9(1):16185. doi: 10.1038/s41598-019-52837-8.
2 GABPA is a master regulator of luminal identity and restrains aggressive diseases in bladder cancer.Cell Death Differ. 2020 Jun;27(6):1862-1877. doi: 10.1038/s41418-019-0466-7. Epub 2019 Dec 4.
3 Knockdown of GA-binding protein subunit 1 inhibits cell proliferation via p21 induction in renal cell carcinoma.Int J Oncol. 2018 Aug;53(2):886-894. doi: 10.3892/ijo.2018.4411. Epub 2018 May 17.
4 Association of SNP rs7181866 in the nuclear respiratory factor-2 beta subunit encoding GABPB1 gene with obesity and type-2 diabetes mellitus in South Indian population.Int J Biol Macromol. 2019 Jul 1;132:606-614. doi: 10.1016/j.ijbiomac.2019.03.125. Epub 2019 Mar 20.
5 A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
6 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
7 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
10 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
11 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
14 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
15 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
16 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
17 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.