Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH1LCGH)

DOT Name Transcription elongation regulator 1 (TCERG1)
Synonyms TATA box-binding protein-associated factor 2S; Transcription factor CA150
Gene Name TCERG1
Related Disease
Narcolepsy ( )
Nervous system disease ( )
Neuroblastoma ( )
Huntington disease ( )
UniProt ID
TCRG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2DK7; 2DOD; 2DOE; 2DOF; 2E71; 2KIQ; 2KIS; 2MW9; 2MWA; 2MWB; 2MWD; 2MWE; 2MWF; 2N4R; 2N4S; 2N4T; 2N4U; 2N4V; 2N4W; 2NNT; 3HFH; 3Q1I; 4FQG; 7ABF; 7ABG
Pfam ID
PF01846 ; PF00397
Sequence
MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
AQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPT
TQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPP
VMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIA
ASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEP
SEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTG
DERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKW
QFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE
ARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERRE
KKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAA
RKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLF
KQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAI
QNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREH
FRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFR
TLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDR
RGPPPPPTASEPTRRSTK
Function
Transcription factor that binds RNA polymerase II and inhibits the elongation of transcripts from target promoters. Regulates transcription elongation in a TATA box-dependent manner. Necessary for TAT-dependent activation of the human immunodeficiency virus type 1 (HIV-1) promoter.
Tissue Specificity Detected in brain neurons.
KEGG Pathway
Spliceosome (hsa03040 )
Reactome Pathway
mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Narcolepsy DISLCNLI Strong Genetic Variation [1]
Nervous system disease DISJ7GGT Disputed Biomarker [2]
Neuroblastoma DISVZBI4 Disputed Biomarker [2]
Huntington disease DISQPLA4 Limited Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Transcription elongation regulator 1 (TCERG1). [3]
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Transcription elongation regulator 1 (TCERG1). [14]
------------------------------------------------------------------------------------
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Transcription elongation regulator 1 (TCERG1). [4]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Transcription elongation regulator 1 (TCERG1). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Transcription elongation regulator 1 (TCERG1). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Transcription elongation regulator 1 (TCERG1). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Transcription elongation regulator 1 (TCERG1). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Transcription elongation regulator 1 (TCERG1). [9]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Transcription elongation regulator 1 (TCERG1). [10]
Selenium DM25CGV Approved Selenium decreases the expression of Transcription elongation regulator 1 (TCERG1). [11]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Transcription elongation regulator 1 (TCERG1). [12]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Transcription elongation regulator 1 (TCERG1). [13]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Transcription elongation regulator 1 (TCERG1). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Transcription elongation regulator 1 (TCERG1). [15]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Transcription elongation regulator 1 (TCERG1). [16]
Phencyclidine DMQBEYX Investigative Phencyclidine decreases the expression of Transcription elongation regulator 1 (TCERG1). [17]
PP-242 DM2348V Investigative PP-242 decreases the expression of Transcription elongation regulator 1 (TCERG1). [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)

References

1 Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
2 Transcriptional Elongation Regulator 1 Affects Transcription and Splicing of Genes Associated with Cellular Morphology and Cytoskeleton Dynamics and Is Required for Neurite Outgrowth in Neuroblastoma Cells and Primary Neuronal Cultures.Mol Neurobiol. 2017 Dec;54(10):7808-7823. doi: 10.1007/s12035-016-0284-6. Epub 2016 Nov 14.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
11 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
12 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
13 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
14 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
17 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
18 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.