General Information of Drug Off-Target (DOT) (ID: OTKVHCV0)

DOT Name Neuronal pentraxin-1 (NPTX1)
Synonyms NP1; Neuronal pentraxin I; NP-I
Gene Name NPTX1
Related Disease
Hepatocellular carcinoma ( )
Alzheimer disease ( )
Amyloidosis ( )
Bipolar disorder ( )
Colon cancer ( )
Colon carcinoma ( )
Neoplasm ( )
Schizophrenia ( )
Spinocerebellar ataxia 50 ( )
Lung cancer ( )
Lung carcinoma ( )
Cervical cancer ( )
Cervical carcinoma ( )
Gastric cancer ( )
Stomach cancer ( )
Colorectal carcinoma ( )
Helicoid peripapillary chorioretinal degeneration ( )
Sandhoff disease ( )
Tay-sachs disease ( )
UniProt ID
NPTX1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6YPE
Pfam ID
PF00354
Sequence
MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQ
LRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGD
LSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSR
VNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
AKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKV
AKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQD
TLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA
TKWTFEACRQIN
Function May be involved in mediating uptake of synaptic material during synapse remodeling or in mediating the synaptic clustering of AMPA glutamate receptors at a subset of excitatory synapses.

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatocellular carcinoma DIS0J828 Definitive Biomarker [1]
Alzheimer disease DISF8S70 Strong Biomarker [2]
Amyloidosis DISHTAI2 Strong Biomarker [3]
Bipolar disorder DISAM7J2 Strong Biomarker [4]
Colon cancer DISVC52G Strong Biomarker [5]
Colon carcinoma DISJYKUO Strong Biomarker [5]
Neoplasm DISZKGEW Strong Altered Expression [1]
Schizophrenia DISSRV2N Strong Biomarker [4]
Spinocerebellar ataxia 50 DISN2Y44 Strong Autosomal dominant [6]
Lung cancer DISCM4YA moderate Posttranslational Modification [7]
Lung carcinoma DISTR26C moderate Posttranslational Modification [7]
Cervical cancer DISFSHPF Disputed Altered Expression [8]
Cervical carcinoma DIST4S00 Disputed Altered Expression [8]
Gastric cancer DISXGOUK Disputed Biomarker [9]
Stomach cancer DISKIJSX Disputed Biomarker [9]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [10]
Helicoid peripapillary chorioretinal degeneration DISFSS5N Limited Biomarker [11]
Sandhoff disease DISELKA4 Limited Biomarker [12]
Tay-sachs disease DISWG5B4 Limited Biomarker [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Neuronal pentraxin-1 (NPTX1). [13]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Neuronal pentraxin-1 (NPTX1). [26]
------------------------------------------------------------------------------------
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Neuronal pentraxin-1 (NPTX1). [14]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Neuronal pentraxin-1 (NPTX1). [15]
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Neuronal pentraxin-1 (NPTX1). [16]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of Neuronal pentraxin-1 (NPTX1). [17]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Neuronal pentraxin-1 (NPTX1). [18]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Neuronal pentraxin-1 (NPTX1). [19]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Neuronal pentraxin-1 (NPTX1). [20]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Neuronal pentraxin-1 (NPTX1). [21]
Triclosan DMZUR4N Approved Triclosan increases the expression of Neuronal pentraxin-1 (NPTX1). [22]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Neuronal pentraxin-1 (NPTX1). [23]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Neuronal pentraxin-1 (NPTX1). [24]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Neuronal pentraxin-1 (NPTX1). [25]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Neuronal pentraxin-1 (NPTX1). [27]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Neuronal pentraxin-1 (NPTX1). [28]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Neuronal pentraxin-1 (NPTX1). [29]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Neuronal pentraxin-1 (NPTX1). [30]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Neuronal pentraxin-1 (NPTX1). [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)

References

1 As a downstream target of the AKT pathway, NPTX1 inhibits proliferation and promotes apoptosis in hepatocellular carcinoma.Biosci Rep. 2019 Jun 4;39(6):BSR20181662. doi: 10.1042/BSR20181662. Print 2019 Jun 28.
2 Neuronal pentraxin 1: A synaptic-derived plasma biomarker in Alzheimer's disease.Neurobiol Dis. 2018 Jun;114:120-128. doi: 10.1016/j.nbd.2018.02.014. Epub 2018 Mar 6.
3 Neuronal pentraxin 1 contributes to the neuronal damage evoked by amyloid-beta and is overexpressed in dystrophic neurites in Alzheimer's brain.J Neurosci. 2006 Dec 6;26(49):12735-47. doi: 10.1523/JNEUROSCI.0575-06.2006.
4 Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder.Bipolar Disord. 2015 Mar;17(2):205-11. doi: 10.1111/bdi.12239. Epub 2014 Jul 23.
5 NPTX1 inhibits colon cancer cell proliferation through down-regulating cyclin A2 and CDK2 expression.Cell Biol Int. 2018 May;42(5):589-597. doi: 10.1002/cbin.10935. Epub 2018 Feb 6.
6 NPTX1 mutations trigger endoplasmic reticulum stress and cause autosomal dominant cerebellar ataxia. Brain. 2022 May 24;145(4):1519-1534. doi: 10.1093/brain/awab407.
7 NPTX1 is a novel epigenetic regulation gene and associated with prognosis in lung cancer.Biochem Biophys Res Commun. 2015 Mar 6;458(2):381-6. doi: 10.1016/j.bbrc.2015.01.124. Epub 2015 Jan 31.
8 Methylation markers for CCNA1 and C13ORF18 are strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer in cervical scrapings.Cancer Epidemiol Biomarkers Prev. 2009 Nov;18(11):3000-7. doi: 10.1158/1055-9965.EPI-09-0405. Epub 2009 Oct 20.
9 NPTX1 promotes metastasis via integrin/FAK signaling in gastric cancer.Cancer Manag Res. 2019 Apr 15;11:3237-3251. doi: 10.2147/CMAR.S196509. eCollection 2019.
10 Novel candidate colorectal cancer biomarkers identified by methylation microarray-based scanning.Endocr Relat Cancer. 2011 Jul 4;18(4):465-78. doi: 10.1530/ERC-11-0083. Print 2011 Aug.
11 Role of neuroparsin 1 in vitellogenesis in the mud crab, Scylla paramamosain.Gen Comp Endocrinol. 2020 Jan 1;285:113248. doi: 10.1016/j.ygcen.2019.113248. Epub 2019 Aug 17.
12 Neuronal pentraxin 1 depletion delays neurodegeneration and extends life in Sandhoff disease mice.Hum Mol Genet. 2017 Feb 15;26(4):661-673. doi: 10.1093/hmg/ddw422.
13 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
14 Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
15 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
16 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
17 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
18 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
19 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
20 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
21 Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
22 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
23 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
24 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
25 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
26 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
27 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
28 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
29 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
30 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
31 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.