Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLFL0DG)

• DOT Name: Pro-cathepsin H (CTSH)
• Gene Name: CTSH
• UniProt ID: CATH_HUMAN
• PDB ID: 6CZK; 6CZS
• EC Number: 3.4.22.16
• Pfam ID: PF08246 ; PF00112
• Sequence:
  MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFAS
  NWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSV
  DWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHG
  CQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMV
  EAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVK
  NSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
• Function: Important for the overall degradation of proteins in lysosomes.
• KEGG Pathway:
  Lysosome (hsa04142)
  Apoptosis (hsa04210)
• Reactome Pathway:
  Surfactant metabolism (R-HSA-5683826)
  Neutrophil degranulation (R-HSA-6798695)
  MHC class II antigen presentation (R-HSA-2132295)

Molecular Interaction Atlas (MIA) of This DOT

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Pro-cathepsin H (CTSH).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Pro-cathepsin H (CTSH).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Pro-cathepsin H (CTSH).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Pro-cathepsin H (CTSH).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Pro-cathepsin H (CTSH).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Pro-cathepsin H (CTSH).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Pro-cathepsin H (CTSH).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Pro-cathepsin H (CTSH).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Pro-cathepsin H (CTSH).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Pro-cathepsin H (CTSH).	[10]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Pro-cathepsin H (CTSH).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Pro-cathepsin H (CTSH).	[12]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Pro-cathepsin H (CTSH).	[13]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Pro-cathepsin H (CTSH).	[14]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Pro-cathepsin H (CTSH).	[15]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Pro-cathepsin H (CTSH).	[8]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Pro-cathepsin H (CTSH).	[16]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Pro-cathepsin H (CTSH).	[17]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of Pro-cathepsin H (CTSH).	[18]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Pro-cathepsin H (CTSH).	[19]
Bexarotene	DMOBIKY	Approved	Bexarotene increases the expression of Pro-cathepsin H (CTSH).	[20]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Pro-cathepsin H (CTSH).	[21]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Pro-cathepsin H (CTSH).	[22]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Pro-cathepsin H (CTSH).	[23]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Pro-cathepsin H (CTSH).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Pro-cathepsin H (CTSH).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Pro-cathepsin H (CTSH).	[26]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Pro-cathepsin H (CTSH).	[27]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Pro-cathepsin H (CTSH).	[28]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Pro-cathepsin H (CTSH).	[29]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Pro-cathepsin H (CTSH).	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pro-cathepsin H (CTSH).	[24]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [11] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [14] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [15] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [16] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [17] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [18] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [19] Comparative gene expression analysis of a chronic myelogenous leukemia cell line resistant to cyclophosphamide using oligonucleotide arrays and response to tyrosine kinase inhibitors. Leuk Res. 2007 Nov;31(11):1511-20.
• [20] Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
• [21] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [22] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [23] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [26] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [27] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [28] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [29] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [30] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.