Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLFSDZD)

DOT Name BPI fold-containing family A member 2 (BPIFA2)
Synonyms Parotid secretory protein; PSP; Short palate, lung and nasal epithelium carcinoma-associated protein 2
Gene Name BPIFA2
Related Disease
Attention deficit hyperactivity disorder ( )
Neoplasm ( )
Schizophrenia ( )
Wolfram syndrome ( )
Advanced cancer ( )
Autonomic nervous system disorder ( )
Bipolar disorder ( )
Corticobasal degeneration ( )
Dementia ( )
Depression ( )
Drug dependence ( )
Dysautonomia ( )
Familial spontaneous pneumothorax ( )
Frontotemporal dementia ( )
Late-onset Parkinson disease ( )
Matthew-Wood syndrome ( )
Myotonic dystrophy ( )
Parkinson disease ( )
Pick disease ( )
Pneumothorax ( )
Postencephalitic Parkinson disease ( )
Primary progressive aphasia ( )
Progressive supranuclear palsy ( )
Prostate adenocarcinoma ( )
Substance abuse ( )
Substance dependence ( )
Tauopathy ( )
Type-1/2 diabetes ( )
Keratoconjunctivitis sicca ( )
Anxiety ( )
Anxiety disorder ( )
Lewy body dementia ( )
Nervous system disease ( )
Nutritional disorder ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
BPIA2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01273
Sequence
MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKV
DLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDG
KGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTS
ISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQ
HKTQLQTLI
Function Has strong antibacterial activity against P. aeruginosa.
Tissue Specificity Detected in submandibular gland. Secreted into saliva.
Reactome Pathway
Antimicrobial peptides (R-HSA-6803157 )

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Attention deficit hyperactivity disorder DISL8MX9 Definitive Biomarker [1]
Neoplasm DISZKGEW Definitive Altered Expression [2]
Schizophrenia DISSRV2N Definitive Altered Expression [1]
Wolfram syndrome DISN16XW Definitive Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Autonomic nervous system disorder DIS6JLTA Strong Biomarker [5]
Bipolar disorder DISAM7J2 Strong Biomarker [6]
Corticobasal degeneration DISSMOTT Strong Biomarker [7]
Dementia DISXL1WY Strong Biomarker [8]
Depression DIS3XJ69 Strong Biomarker [6]
Drug dependence DIS9IXRC Strong Biomarker [9]
Dysautonomia DISF4MT6 Strong Biomarker [5]
Familial spontaneous pneumothorax DISNM7SU Strong Biomarker [10]
Frontotemporal dementia DISKYHXL Strong Biomarker [11]
Late-onset Parkinson disease DIS9IOUI Strong Biomarker [12]
Matthew-Wood syndrome DISA7HR7 Strong Genetic Variation [2]
Myotonic dystrophy DISNBEMX Strong Biomarker [5]
Parkinson disease DISQVHKL Strong Genetic Variation [13]
Pick disease DISP6X50 Strong Genetic Variation [14]
Pneumothorax DISP86H1 Strong Genetic Variation [15]
Postencephalitic Parkinson disease DIS1TYXP Strong Biomarker [8]
Primary progressive aphasia DISLRYFE Strong Biomarker [16]
Progressive supranuclear palsy DISO5KRQ Strong Biomarker [17]
Prostate adenocarcinoma DISBZYU8 Strong Genetic Variation [18]
Substance abuse DIS327VW Strong Biomarker [9]
Substance dependence DISDRAAR Strong Biomarker [9]
Tauopathy DISY2IPA Strong Genetic Variation [14]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [3]
Keratoconjunctivitis sicca DISNOENH moderate Biomarker [19]
Anxiety DISIJDBA Disputed Biomarker [20]
Anxiety disorder DISBI2BT Disputed Biomarker [20]
Lewy body dementia DISAE66J Limited Biomarker [21]
Nervous system disease DISJ7GGT Limited Biomarker [17]
Nutritional disorder DIS0W6QK Limited Biomarker [22]
Prostate cancer DISF190Y Limited Biomarker [23]
Prostate carcinoma DISMJPLE Limited Biomarker [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 36 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of BPI fold-containing family A member 2 (BPIFA2). [24]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of BPI fold-containing family A member 2 (BPIFA2). [25]
------------------------------------------------------------------------------------

References

1 Cognitive and behavioral precursors of schizophrenia.Dev Psychopathol. 1999 Summer;11(3):487-508. doi: 10.1017/s0954579499002175.
2 Human pancreatic cancer contains a side population expressing cancer stem cell-associated and prognostic genes.PLoS One. 2013 Sep 17;8(9):e73968. doi: 10.1371/journal.pone.0073968. eCollection 2013.
3 Pancreatic stone protein/regenerating protein is a potential biomarker for endoplasmic reticulum stress in beta cells.Sci Rep. 2019 Mar 26;9(1):5199. doi: 10.1038/s41598-019-41604-4.
4 Analyzing the capability of PSP, PCT and sCD25 to support the diagnosis of infection in cancer patients with febrile neutropenia.Clin Chem Lab Med. 2019 Mar 26;57(4):540-548. doi: 10.1515/cclm-2018-0154.
5 Coexistence of Progressive Supranuclear Palsy With Pontocerebellar Atrophy and Myotonic Dystrophy Type 1.J Neuropathol Exp Neurol. 2019 Aug 1;78(8):756-762. doi: 10.1093/jnen/nlz048.
6 Self-Reported Graphic Personal and Social Performance Scale (SRG-PSP) for measuring functionality in patients with bipolar disorder.J Affect Disord. 2017 Jun;215:256-262. doi: 10.1016/j.jad.2017.02.018. Epub 2017 Feb 20.
7 Side effects induced by the acute levodopa challenge in Parkinson's Disease and atypical parkinsonisms.PLoS One. 2017 Feb 16;12(2):e0172145. doi: 10.1371/journal.pone.0172145. eCollection 2017.
8 Parkinson's syndrome associated with neurofibrillary degeneration and tau pathologic findings.Mov Disord. 2003 Sep;18 Suppl 6:S28-33. doi: 10.1002/mds.10560.
9 Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
10 A novel dual-covering method in video-assisted thoracic surgery for pediatric primary spontaneous pneumothorax.Surg Today. 2019 Jul;49(7):587-592. doi: 10.1007/s00595-019-01785-x. Epub 2019 Apr 6.
11 Cerebellar atrophy in neurodegeneration-a meta-analysis.J Neurol Neurosurg Psychiatry. 2017 Sep;88(9):780-788. doi: 10.1136/jnnp-2017-315607. Epub 2017 May 13.
12 Manual MRI morphometry in Parkinsonian syndromes.Mov Disord. 2017 May;32(5):778-782. doi: 10.1002/mds.26921. Epub 2017 Feb 2.
13 The genetic and clinico-pathological profile of early-onset progressive supranuclear palsy.Mov Disord. 2019 Sep;34(9):1307-1314. doi: 10.1002/mds.27786. Epub 2019 Jul 12.
14 Involvement of Oligodendrocytes in Tau Seeding and Spreading in Tauopathies.Front Aging Neurosci. 2019 May 28;11:112. doi: 10.3389/fnagi.2019.00112. eCollection 2019.
15 Primary and Secondary Spontaneous Pneumothorax: Prevalence, Clinical Features, and In-Hospital Mortality.Can Respir J. 2017;2017:6014967. doi: 10.1155/2017/6014967. Epub 2017 Mar 13.
16 C9ORF72 repeat expansions in the frontotemporal dementias spectrum of diseases: a flow-chart for genetic testing.J Alzheimers Dis. 2013;34(2):485-99. doi: 10.3233/JAD-121456.
17 Sensitivity and Specificity of Diagnostic Criteria for Progressive Supranuclear Palsy.Mov Disord. 2019 Aug;34(8):1144-1153. doi: 10.1002/mds.27619. Epub 2019 Feb 6.
18 A novel knock-in prostate cancer model demonstrates biology similar to that of human prostate cancer and suitable for preclinical studies.Mol Ther. 2005 Mar;11(3):348-62. doi: 10.1016/j.ymthe.2004.12.005.
19 Prevalence of Novel Candidate Sjgren Syndrome Autoantibodies in the Penn Sjgren's International Collaborative Clinical Alliance Cohort.Cornea. 2019 Dec;38(12):1500-1505. doi: 10.1097/ICO.0000000000002147.
20 Psychological factors predict an unfavorable pain trajectory after hysterectomy: a prospective cohort study on chronic postsurgical pain.Pain. 2018 May;159(5):956-967. doi: 10.1097/j.pain.0000000000001170.
21 Non-Alzheimer's disease dementias: anatomic, clinical, and molecular correlates.Can J Psychiatry. 2004 Mar;49(3):164-71. doi: 10.1177/070674370404900303.
22 Radiolucent and calcified pancreatic lithiasis: two different diseases. Role of alcohol and heredity.Scand J Gastroenterol. 1992;27(1):71-6. doi: 10.3109/00365529209011170.
23 Comparison of prostate-specific promoters and the use of PSP-driven virotherapy for prostate cancer.Biomed Res Int. 2013;2013:624632. doi: 10.1155/2013/624632. Epub 2013 Jan 31.
24 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
25 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.