General Information of Drug Off-Target (DOT) (ID: OTOK8M0V)

DOT Name Mast cell carboxypeptidase A (CPA3)
Synonyms MC-CPA; EC 3.4.17.1; Carboxypeptidase A3
Gene Name CPA3
Related Disease
Coronary atherosclerosis ( )
Coronary heart disease ( )
Eosinophilic esophagitis ( )
Lung adenocarcinoma ( )
Mastocytosis ( )
Myocardial infarction ( )
Nasal polyp ( )
Asthma ( )
Melanoma ( )
UniProt ID
CBPA3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.4.17.1
Pfam ID
PF00246 ; PF02244
Sequence
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
KEGG Pathway
Renin-angiotensin system (hsa04614 )
Pancreatic secretion (hsa04972 )
Protein digestion and absorption (hsa04974 )
Reactome Pathway
Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Coronary atherosclerosis DISKNDYU Strong Biomarker [1]
Coronary heart disease DIS5OIP1 Strong Biomarker [1]
Eosinophilic esophagitis DISR8WSB Strong Altered Expression [2]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [3]
Mastocytosis DIS1TEE0 Strong Biomarker [4]
Myocardial infarction DIS655KI Strong Biomarker [1]
Nasal polyp DISLP3XE Strong Altered Expression [5]
Asthma DISW9QNS Limited Biomarker [6]
Melanoma DIS1RRCY Limited Altered Expression [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Mast cell carboxypeptidase A (CPA3). [8]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Mast cell carboxypeptidase A (CPA3). [9]
Selenium DM25CGV Approved Selenium decreases the expression of Mast cell carboxypeptidase A (CPA3). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Mast cell carboxypeptidase A (CPA3). [11]
------------------------------------------------------------------------------------

References

1 Mast cell derived carboxypeptidase A3 is decreased among patients with advanced coronary artery disease.Cardiol J. 2019;26(6):680-686. doi: 10.5603/CJ.a2018.0018. Epub 2018 Mar 7.
2 A Distinct Esophageal mRNA Pattern Identifies Eosinophilic Esophagitis Patients With Food Impactions.Front Immunol. 2018 Nov 5;9:2059. doi: 10.3389/fimmu.2018.02059. eCollection 2018.
3 Interleukin-1 provided by KIT-competent mast cells is required for KRAS-mutant lung adenocarcinoma.Oncoimmunology. 2019 Apr 11;8(7):1593802. doi: 10.1080/2162402X.2019.1593802. eCollection 2019.
4 Involvement of mast cells in eosinophilic esophagitis.J Allergy Clin Immunol. 2010 Jul;126(1):140-9. doi: 10.1016/j.jaci.2010.04.009. Epub 2010 Jun 9.
5 Glandular mast cells with distinct phenotype are highly elevated in chronic rhinosinusitis with nasal polyps.J Allergy Clin Immunol. 2012 Aug;130(2):410-20.e5. doi: 10.1016/j.jaci.2012.02.046. Epub 2012 Apr 24.
6 A sputum 6-gene signature predicts future exacerbations of poorly controlled asthma.J Allergy Clin Immunol. 2019 Jul;144(1):51-60.e11. doi: 10.1016/j.jaci.2018.12.1020. Epub 2019 Jan 22.
7 The combined action of mast cell chymase, tryptase and carboxypeptidase A3 protects against melanoma colonization of the lung.Oncotarget. 2017 Apr 11;8(15):25066-25079. doi: 10.18632/oncotarget.15339.
8 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
9 The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
10 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.